|
F5 Silverline Alert Generated Timestamp
|
f5silverlinealertgeneratedtimestamp |
shortText |
F5 Silverline
|
No |
0 |
|
APD Admin Recipients
|
apdadminrecipients |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Alert Definition Name
|
apdalertdefinitionname |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Attack Types
|
apdattacktypes |
grid |
Agari Phishing Defense
|
No |
0 |
|
APD Created At
|
apdcreatedat |
date |
Agari Phishing Defense
|
No |
0 |
|
APD Enforcement Action
|
apdenforcementaction |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Global Message ID
|
apdglobalmessageid |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Internal Message ID
|
apdinternalmessageid |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message Authentication Results
|
apdmessageauthenticationresults |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message Authenticity Score
|
apdmessageauthenticityscore |
number |
Agari Phishing Defense
|
No |
0 |
|
APD Message DKIM D Tag
|
apdmessagedkimdtag |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message Date
|
apdmessagedate |
date |
Agari Phishing Defense
|
No |
0 |
|
APD Message Domain Reputation
|
apdmessagedomainreputation |
number |
Agari Phishing Defense
|
No |
0 |
|
APD Message From
|
apdmessagefrom |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message From Domain
|
apdmessagefromdomain |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message Mail From
|
apdmessagemailfrom |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message PTR Name
|
apdmessageptrname |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message Reply To
|
apdmessagereplyto |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message Reputation
|
apdmessagereputation |
number |
Agari Phishing Defense
|
No |
0 |
|
APD Message Risk Reason
|
apdmessageriskreason |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message Sender IP Address
|
apdmessagesenderipaddress |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message Subject
|
apdmessagesubject |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message To
|
apdmessageto |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Message Trust Score
|
apdmessagetrustscore |
number |
Agari Phishing Defense
|
No |
0 |
|
APD Notified Original Recipients
|
apdnotifiedoriginalrecipients |
boolean |
Agari Phishing Defense
|
No |
0 |
|
APD Policy Action
|
apdpolicyaction |
shortText |
Agari Phishing Defense
|
No |
0 |
|
APD Policy Enabled
|
apdpolicyenabled |
boolean |
Agari Phishing Defense
|
No |
0 |
|
APD Policy Event ID
|
apdpolicyeventid |
number |
Agari Phishing Defense
|
No |
0 |
|
APD Summary
|
apdsummary |
boolean |
Agari Phishing Defense
|
No |
0 |
|
APD Updated At
|
apdupdatedat |
date |
Agari Phishing Defense
|
No |
0 |
|
ASM - Alert Summary
|
asmalertsummary |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Asset Hierarchy
|
asmassethierarchy |
shortText |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Asset ID
|
asmassetid |
multiSelect |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Attack Surface Rule Category
|
asmattacksurfacerulecategory |
shortText |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Attack Surface Rule Description
|
asmattacksurfaceruledescription |
longText |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Attack Surface Rule ID
Hidden
|
asmattacksurfaceruleid |
multiSelect |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Attack Surface Rule Priority
|
asmattacksurfacerulepriority |
shortText |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Attack Surface Rule Remediation Guidance
|
asmattacksurfaceruleremediationguidance |
longText |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Cloud
|
asmcloud |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Data Collection
|
asmdatacollection |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Dev Check
|
asmdevcheck |
boolean |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Dev Check Details
|
asmdevcheckdetails |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Enrichment Status
|
asmenrichmentstatus |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Notification
|
asmnotification |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Playbook Stage
|
asmplaybookstage |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Private IP
|
asmprivateip |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Protocol
|
asmprotocol |
multiSelect |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Provider
|
asmprovider |
multiSelect |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Related
Hidden
|
asmrelated |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Remediation
|
asmremediation |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Remediation Objectives
|
asmremediationobjectives |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Remediation Path Rule
|
asmremediationpathrule |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Service Detection
|
asmservicedetection |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Service ID
|
asmserviceid |
multiSelect |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Service Owner
|
asmserviceowner |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Service Owner Unranked Raw
|
asmserviceownerunrankedraw |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - System IDs
|
asmsystemids |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASM - Tags
|
asmtags |
grid |
Cortex Attack Surface Management
|
No |
0 |
|
ASN
|
asn |
shortText |
Common Types
|
No |
0 |
|
ASN Name
|
asnname |
shortText |
Common Types
|
No |
0 |
|
AWS Arn
|
awsarn |
shortText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Access Key Details
|
awsguarddutyaccesskeydetails |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Confidence Score
|
awsguarddutyconfidencescore |
number |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Container Details
|
awsguarddutycontainerdetails |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Ebs Volume Details
|
awsguarddutyebsvolumedetails |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Ecs Cluster Details
|
awsguarddutyecsclusterdetails |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Eks Cluster Details
|
awsguarddutyeksclusterdetails |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Iam Instance Profile
|
awsguarddutyiaminstanceprofile |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Instance Details
|
awsguarddutyinstancedetails |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Kubernetes User Details
|
awsguarddutykubernetesuserdetails |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Kubernetes Workload Details
|
awsguarddutykubernetesworkloaddetails |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Network Interface
|
awsguarddutynetworkinterface |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Partition
|
awsguarddutypartition |
shortText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Resource Type
|
awsguarddutyresourcetype |
shortText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty S3 Bucket Details
|
awsguarddutys3bucketdetails |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Schema Version
|
awsguarddutyschemaversion |
shortText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Service
|
awsguarddutyservice |
longText |
AWS - GuardDuty
|
No |
0 |
|
AWS GuardDuty Type
|
awsguarddutytype |
shortText |
AWS - GuardDuty
|
No |
0 |
|
AWS Security Hub Action
|
awssecurityhubaction |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Company Name
|
awssecurityhubcompanyname |
shortText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Compliance
|
awssecurityhubcompliance |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Confidence
|
awssecurityhubconfidence |
number |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Criticality
|
awssecurityhubcriticality |
number |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Generator Id
|
awssecurityhubgeneratorid |
shortText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Malware
|
awssecurityhubmalware |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Network Path
|
awssecurityhubnetworkpath |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Product Arn
|
awssecurityhubproductarn |
shortText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Product Fields
|
awssecurityhubproductfields |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Product Name
|
awssecurityhubproductname |
shortText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Provider Fields
|
awssecurityhubproviderfields |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Provider Updated At
|
awssecurityhubproviderupdatedat |
date |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Record State
|
awssecurityhubrecordstate |
shortText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Related Findings
|
awssecurityhubrelatedfindings |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Remediation
|
awssecurityhubremediation |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Resources
|
awssecurityhubresources |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Schema Version
|
awssecurityhubschemaversion |
shortText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Severity
|
awssecurityhubseverity |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Threat Intel Indicators
|
awssecurityhubthreatintelindicators |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Threats
|
awssecurityhubthreats |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Types
|
awssecurityhubtypes |
shortText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub User Defined Fields
|
awssecurityhubuserdefinedfields |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Verification State
|
awssecurityhubverificationstate |
multiSelect |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Vulnerabilities
|
awssecurityhubvulnerabilities |
longText |
AWS - Security Hub
|
No |
0 |
|
AWS Security Hub Workflow Status
|
awssecurityhubworkflowstatus |
multiSelect |
AWS - Security Hub
|
No |
0 |
|
Abnormal Security Abuse Campaign Attack Type
|
abnormalsecurityabusecampaignattacktype |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Abuse Campaign First Reported
|
abnormalsecurityabusecampaignfirstreported |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Abuse Campaign From Address
|
abnormalsecurityabusecampaignfromaddress |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Abuse Campaign From Name
|
abnormalsecurityabusecampaignfromname |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Abuse Campaign ID
|
abnormalsecurityabusecampaignid |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Abuse Campaign Judgement Status
|
abnormalsecurityabusecampaignjudgementstatus |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Abuse Campaign Last Reported
|
abnormalsecurityabusecampaignlastreported |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Abuse Campaign Message ID
|
abnormalsecurityabusecampaignmessageid |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Abuse Campaign Overall Status
|
abnormalsecurityabusecampaignoverallstatus |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Abuse Campaign Recipient Address
|
abnormalsecurityabusecampaignrecipientaddress |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Abuse Campaign Recipient Name
|
abnormalsecurityabusecampaignrecipientname |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Abuse Campaign Subject
|
abnormalsecurityabusecampaignsubject |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Affected Employee
|
abnormalsecurityaffectedemployee |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Analysis
|
abnormalsecurityanalysis |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Attachment Count
|
abnormalsecurityattachmentcount |
number |
Abnormal Security
|
No |
0 |
|
Abnormal Security Attachment Names
|
abnormalsecurityattachmentnames |
multiSelect |
Abnormal Security
|
No |
0 |
|
Abnormal Security Attack Strategy
|
abnormalsecurityattackstrategy |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Attack Type
|
abnormalsecurityattacktype |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Attack Vector
|
abnormalsecurityattackvector |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Attacked Party
|
abnormalsecurityattackedparty |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Auto Remediated
|
abnormalsecurityautoremediated |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security CC Emails
|
abnormalsecurityccemails |
multiSelect |
Abnormal Security
|
No |
0 |
|
Abnormal Security Campaign ID
|
abnormalsecuritycampaignid |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Case GenAI Summary
|
abnormalsecuritycasegenaisummary |
longText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Case ID
|
abnormalsecuritycaseid |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Case Status
|
abnormalsecuritycasestatus |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Customer Visible Time
|
abnormalsecuritycustomervisibletime |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security First Observed Time
|
abnormalsecurityfirstobservedtime |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security First Reported
|
abnormalsecurityfirstreported |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security From Address
|
abnormalsecurityfromaddress |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security From Name
|
abnormalsecurityfromname |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Impersonated Party
|
abnormalsecurityimpersonatedparty |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Internet Message ID
|
abnormalsecurityinternetmessageid |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Is Read
|
abnormalsecurityisread |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Judgement Status
|
abnormalsecurityjudgementstatus |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Last Reported
|
abnormalsecuritylastreported |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Message ID
|
abnormalsecuritymessageid |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Overall Status
|
abnormalsecurityoverallstatus |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Portal URL
|
abnormalsecurityportalurl |
longText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Post Remediated
|
abnormalsecuritypostremediated |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Received Time
|
abnormalsecurityreceivedtime |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Recipient Address
|
abnormalsecurityrecipientaddress |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Recipient Name
|
abnormalsecurityrecipientname |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Remediation Status
|
abnormalsecurityremediationstatus |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Remediation Timestamp
|
abnormalsecurityremediationtimestamp |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Reply To Emails
|
abnormalsecurityreplytoemails |
multiSelect |
Abnormal Security
|
No |
0 |
|
Abnormal Security Return Path
|
abnormalsecurityreturnpath |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Sender Domain
|
abnormalsecuritysenderdomain |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Sender IP Address
|
abnormalsecuritysenderipaddress |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Sent Time
|
abnormalsecuritysenttime |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Severity
|
abnormalsecurityseverity |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Severity Level
|
abnormalsecurityseveritylevel |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Subject
|
abnormalsecuritysubject |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Summary Insights
|
abnormalsecuritysummaryinsights |
multiSelect |
Abnormal Security
|
No |
0 |
|
Abnormal Security Threat ID
|
abnormalsecuritythreatid |
shortText |
Abnormal Security
|
No |
0 |
|
Abnormal Security Threat IDs
|
abnormalsecuritythreatids |
multiSelect |
Abnormal Security
|
No |
0 |
|
Abnormal Security To Addresses
|
abnormalsecuritytoaddresses |
multiSelect |
Abnormal Security
|
No |
0 |
|
Abnormal Security Url Count
|
abnormalsecurityurlcount |
number |
Abnormal Security
|
No |
0 |
|
Account Groups
|
accountgroups |
shortText |
Brute Force
|
No |
0 |
|
Account ID
|
accountid |
shortText |
Common Types
|
No |
0 |
|
Account Member Of
|
accountmemberof |
multiSelect |
Common Types
|
No |
0 |
|
Account Name
|
accountname |
shortText |
Common Types
|
No |
0 |
|
Account Status
|
accountstatus |
shortText |
Common Types
|
No |
0 |
|
Account information breached
|
accountinformationbreached |
shortText |
Common Scripts
|
No |
0 |
|
Acknowledged
|
acknowledged |
boolean |
Nutanix Hypervisor
|
No |
0 |
|
Acknowledged By Username
|
acknowledgedbyusername |
shortText |
Nutanix Hypervisor
|
No |
0 |
|
Acquisition Hire
|
acquisitionhire |
shortText |
Common Types
|
No |
0 |
|
Action
|
action |
singleSelect |
FireMon Security Manager
|
No |
0 |
|
Action
|
action |
singleSelect |
Core Alert Fields
|
No |
0 |
|
Action Process Instance ID
|
actionprocessinstanceid |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Actions On Campaign Incidents
|
actionsoncampaignincidents |
singleSelect |
Phishing Campaign
|
No |
0 |
|
Actions On Low Similarity Incidents
|
actionsonlowsimilarityincidents |
singleSelect |
Phishing Campaign
|
No |
0 |
|
Active Directory Account Status
|
activedirectoryaccountstatus |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Active Directory Display Name
|
activedirectorydisplayname |
shortText |
Employee Offboarding
|
No |
0 |
|
Active Directory Password Status
|
activedirectorypasswordstatus |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Actor
|
cybersixgillactor |
shortText |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Actor Process Instance ID
|
actorprocessinstanceid |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Add BCC To Email
|
addbcctoemail |
shortText |
Email Communication
|
No |
0 |
|
Add CC To Email
|
addcctoemail |
shortText |
Email Communication
|
No |
0 |
|
Additional Data
|
additionaldata |
multiSelect |
Common Types
|
No |
0 |
|
Additional Email Addresses
|
additionalemailaddresses |
multiSelect |
Common Types
|
No |
0 |
|
Additional Indicators
|
additionalindicators |
shortText |
Common Types
|
No |
0 |
|
Affected Data Type
|
affecteddatatype |
shortText |
Common Scripts
|
No |
0 |
|
Affected Entities
|
affectedentities |
number |
XM Cyber
|
No |
0 |
|
Affected Entities List
|
affectedentitieslist |
grid |
XM Cyber
|
No |
0 |
|
Affected Host
|
affectedhost |
shortText |
Use Case Builder
|
No |
0 |
|
Affected Hosts
|
affectedhosts |
tagsSelect |
Common Types
|
No |
0 |
|
Affected Individuals Contact Information
|
affectedindividualscontactinformation |
grid |
Common Scripts
|
No |
0 |
|
Affected Users
|
affectedusers |
tagsSelect |
Common Types
|
No |
0 |
|
Affected data
|
affecteddata |
multiSelect |
Common Scripts
|
No |
0 |
|
Agent ID
|
agentid |
shortText |
Common Types
|
No |
0 |
|
Agent Id
|
agentid |
shortText |
Core Alert Fields
|
No |
0 |
|
Agent OS Sub Type
|
agentossubtype |
shortText |
Core Alert Fields
|
No |
0 |
|
Agent Version
|
agentversion |
multiSelect |
Common Types
|
No |
0 |
|
Agents ID
|
agentsid |
multiSelect |
Common Types
|
No |
0 |
|
Alert Acknowledgement
|
alertacknowledgement |
shortText |
Common Types
|
No |
0 |
|
Alert Action
|
alertaction |
shortText |
Common Types
|
No |
0 |
|
Alert Attack Time
|
alertattacktime |
shortText |
Common Types
|
No |
0 |
|
Alert Category
|
alertcategory |
shortText |
Common Types
|
No |
0 |
|
Alert Closing User
|
alertclosinguser |
shortText |
Nutanix Hypervisor
|
No |
0 |
|
Alert ID
|
alertid |
shortText |
Common Types
|
No |
0 |
|
Alert Malicious
|
alertmalicious |
shortText |
Common Types
|
No |
0 |
|
Alert Name
|
alertname |
shortText |
Common Types
|
No |
0 |
|
Alert Rules
|
alertrules |
markdown |
Common Types
|
No |
0 |
|
Alert Search Results
|
alertsearchresults |
grid |
Core Alert Fields
|
No |
0 |
|
Alert Source
|
alertsource |
shortText |
Common Types
|
No |
0 |
|
Alert Type ID
|
alerttypeid |
shortText |
Common Types
|
No |
0 |
|
Alert Type UUID
|
alerttypeuuid |
shortText |
Nutanix Hypervisor
|
No |
0 |
|
Alert URL
|
alerturl |
shortText |
Common Types
|
No |
0 |
|
Alert tags
|
alerttags |
shortText |
Common Types
|
No |
0 |
|
Alerts and related info
|
alertsandrelatedinfo |
grid |
Malware Investigation and Response
|
No |
0 |
|
Analysis Report
|
analysisreport |
multiSelect |
Malware Core
|
No |
0 |
|
Anti-Spyware Profile Name
|
antispywareprofilename |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Anti-Spyware Profile Status
|
antispywareprofilestatus |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Anti-Spyware Rules
|
antispywarerules |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Anti-Virus Profile Name
|
antivirusprofilename |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Anti-Virus Profile Status
|
antivirusprofilestatus |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Anti-Virus Rules
|
antivirusrules |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Anything LLM Conversation
|
anythingllmconversation |
markdown |
Anything LLM
|
No |
0 |
|
Anything LLM Curthread
|
anythingllmcurthread |
longText |
Anything LLM
|
No |
0 |
|
Anything LLM Documents
|
anythingllmdocuments |
grid |
Anything LLM
|
No |
0 |
|
Anything LLM Embeddings
|
anythingllmembeddings |
grid |
Anything LLM
|
No |
0 |
|
Anything LLM Newcontext
|
anythingllmnewcontext |
longText |
Anything LLM
|
No |
0 |
|
Anything LLM Search Results
|
anythingllmsearchresults |
longText |
Anything LLM
|
No |
0 |
|
Anything LLM Upload
|
anythingllmupload |
longText |
Anything LLM
|
No |
0 |
|
Anything LLM Workspace
|
anythingllmworkspace |
shortText |
Anything LLM
|
No |
0 |
|
Anything LLM Workspace List
|
anythingllmworkspacelist |
grid |
Anything LLM
|
No |
0 |
|
App
|
app |
shortText |
Common Types
|
No |
0 |
|
App Category
|
appcategory |
multiSelect |
Core Alert Fields
|
No |
0 |
|
App Technology
|
apptechnology |
multiSelect |
Core Alert Fields
|
No |
0 |
|
App message
|
appmessage |
longText |
Common Types
|
No |
0 |
|
App-id
|
appid |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Appliance ID
|
applianceid |
shortText |
Common Types
|
No |
0 |
|
Appliance Name
|
appliancename |
shortText |
Common Types
|
No |
0 |
|
Application Id
|
applicationid |
shortText |
Common Types
|
No |
0 |
|
Application Name
|
applicationname |
shortText |
Common Types
|
No |
0 |
|
Application Path
|
applicationpath |
shortText |
Common Types
|
No |
0 |
|
Approval Status
|
approvalstatus |
shortText |
Common Types
|
No |
0 |
|
Approver
|
approver |
shortText |
Common Types
|
No |
0 |
|
Approximate number of affected data subjects
|
approximatenumberofaffecteddatasubjects |
shortText |
Common Scripts
|
No |
0 |
|
Argus Attachment ID
|
argusattachmentid |
number |
mnemonic MDR
|
No |
0 |
|
Argus Case Category
|
arguscasecategory |
shortText |
mnemonic MDR
|
No |
0 |
|
Argus Case HTML
|
arguscasehtml |
html |
mnemonic MDR
|
No |
0 |
|
Argus Case ID
|
arguscaseid |
number |
mnemonic MDR
|
No |
0 |
|
Argus Case Link
|
arguscaselink |
url |
mnemonic MDR
|
No |
0 |
|
Argus Case Service
|
arguscaseservice |
shortText |
mnemonic MDR
|
No |
0 |
|
Argus Case Status
|
arguscasestatus |
shortText |
mnemonic MDR
|
No |
0 |
|
Argus Case Type
|
arguscasetype |
shortText |
mnemonic MDR
|
No |
0 |
|
Argus Comment ID
|
arguscommentid |
number |
mnemonic MDR
|
No |
0 |
|
Argus Customer ID
|
arguscustomerid |
number |
mnemonic MDR
|
No |
0 |
|
Argus Event ID
|
arguseventid |
number |
mnemonic MDR
|
No |
0 |
|
Argus Event Type
|
arguseventtype |
shortText |
mnemonic MDR
|
No |
0 |
|
Argus Tag ID
|
argustagid |
number |
mnemonic MDR
|
No |
0 |
|
Armis Alert Description
|
armisalertdescription |
shortText |
Armis
|
No |
0 |
|
Armis Alert ID
|
armisalertid |
shortText |
Armis
|
No |
0 |
|
Armis Alert Severity
|
armisalertseverity |
shortText |
Armis
|
No |
0 |
|
Armis Alert Status
|
armisalertstatus |
shortText |
Armis
|
No |
0 |
|
Armis Alert Type
|
armisalerttype |
shortText |
Armis
|
No |
0 |
|
Armis Device IDs
|
armisdeviceid |
shortText |
Armis
|
No |
0 |
|
Armis Device Identifier
|
armisdeviceidentifier |
shortText |
Armis
|
No |
0 |
|
Armis Device Risk Level
|
armisdevicerisklevel |
shortText |
Armis
|
No |
0 |
|
Armorblox Incident Id
|
armorbloxincidentid |
shortText |
Armorblox
|
No |
0 |
|
Armorblox Policy Names
|
armorbloxpolicynames |
longText |
Armorblox
|
No |
0 |
|
Armorblox Remediation Actions
|
armorbloxremediationactions |
longText |
Armorblox
|
No |
0 |
|
Armorblox Resolution State
|
armorbloxresolutionstate |
shortText |
Armorblox
|
No |
0 |
|
Armorblox Subject
|
armorbloxsubject |
shortText |
Armorblox
|
No |
0 |
|
Asimily Anomaly Alert ID
|
asimilyanomalyalertid |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Category
|
asimilyanomalycategory |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Criticality
|
asimilyanomalycriticality |
singleSelect |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Criticality Score
|
asimilyanomalycriticalityscore |
number |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Customer Anomaly ID
|
asimilyanomalycustomeranomalyid |
number |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Description
|
asimilyanomalydescription |
longText |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Earliest Trigger Time
|
asimilyanomalyearliesttriggertime |
date |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Fix By
|
asimilyanomalyfixby |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Is Fixed
|
asimilyanomalyisfixed |
boolean |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Last Trigger Time
|
asimilyanomalylasttriggertime |
date |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Mitre Tactic
|
asimilyanomalymitretactic |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Mitre Technique
|
asimilyanomalymitretechnique |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly Name
|
asimilyanomalyname |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily Anomaly URLs
|
asimilyanomalyurls |
multiSelect |
Asimily Insight
|
No |
0 |
|
Asimily CVE CVSS 3 Base Score
|
asimilycvecvss3basescore |
number |
Asimily Insight
|
No |
0 |
|
Asimily CVE CWE Type
|
asimilycvecwetype |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily CVE Description
|
asimilycvedescription |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily CVE Entity Name
|
asimilycveentityname |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily CVE Entity Type
|
asimilycveentitytype |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily CVE Exploitable In Wild
|
asimilycveexploitableinwild |
boolean |
Asimily Insight
|
No |
0 |
|
Asimily CVE Fixed By
|
asimilycvefixedby |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily CVE Fixed Date
|
asimilycvefixeddate |
date |
Asimily Insight
|
No |
0 |
|
Asimily CVE Is Fixed
|
asimilycveisfixed |
boolean |
Asimily Insight
|
No |
0 |
|
Asimily CVE Is Muted
|
asimilycveismuted |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily CVE Name
|
asimilycvename |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily CVE OEM Patched
|
asimilycveoempatched |
boolean |
Asimily Insight
|
No |
0 |
|
Asimily CVE Open Date
|
asimilycveopendate |
date |
Asimily Insight
|
No |
0 |
|
Asimily CVE Published Date
|
asimilycvepublisheddate |
date |
Asimily Insight
|
No |
0 |
|
Asimily CVE Score
|
asimilycvescore |
number |
Asimily Insight
|
No |
0 |
|
Asimily Device Families
|
asimilydevicefamilies |
tagsSelect |
Asimily Insight
|
No |
0 |
|
Asimily Device Host Name
|
asimilydevicehostname |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily Device ID
|
asimilydeviceid |
number |
Asimily Insight
|
No |
0 |
|
Asimily Device IPV4 Address
|
asimilydeviceipv4address |
tagsSelect |
Asimily Insight
|
No |
0 |
|
Asimily Device MAC Address
|
asimilydevicemacaddress |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily Device Manufacturer
|
asimilydevicemanufacturer |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily Device Model
|
asimilydevicemodel |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily Device OS
|
asimilydeviceos |
shortText |
Asimily Insight
|
No |
0 |
|
Asimily Device Type
|
asimilydevicetype |
shortText |
Asimily Insight
|
No |
0 |
|
Asset ID
|
assetid |
shortText |
Common Types
|
No |
0 |
|
Asset Name
|
assetname |
shortText |
Common Types
|
No |
0 |
|
Asset Table
|
assettable |
markdown |
Asset
|
No |
0 |
|
Assigned User
|
assigneduser |
shortText |
Common Types
|
No |
0 |
|
Assignment Group
|
assignmentgroup |
shortText |
Common Types
|
No |
0 |
|
Associated Malicious Domains
|
associatedmaliciousdomains |
shortText |
Port Scan
|
No |
0 |
|
Ataya_ID
|
atayaid |
shortText |
Ataya
|
No |
0 |
|
Ataya_IMEI
|
atayaimei |
shortText |
Ataya
|
No |
0 |
|
Ataya_IMSI
|
atayaimsi |
shortText |
Ataya
|
No |
0 |
|
Attachment Count
|
attachmentcount |
number |
Phishing
|
No |
0 |
|
Attachment Extension
|
attachmentextension |
shortText |
Phishing
|
No |
0 |
|
Attachment Hash
|
attachmenthash |
shortText |
Phishing
|
No |
0 |
|
Attachment ID
|
attachmentid |
shortText |
Phishing
|
No |
0 |
|
Attachment Name
|
attachmentname |
shortText |
Phishing
|
No |
0 |
|
Attachment size
|
attachmentsize |
shortText |
Phishing
|
No |
0 |
|
Attachment type
|
attachmenttype |
shortText |
Phishing
|
No |
0 |
|
Attack Mode
|
attackmode |
shortText |
Common Types
|
No |
0 |
|
Attack Patterns
|
attackpatterns |
tagsSelect |
Common Types
|
No |
0 |
|
Attacker Host Isolated
|
attackerhostisolated |
boolean |
Port Scan
|
No |
0 |
|
Attacker IP Blocked
|
attackeripblocked |
boolean |
Port Scan
|
No |
0 |
|
Attorney General Notification
|
attorneygeneralnotification |
singleSelect |
Common Scripts
|
No |
0 |
|
Audit Logs
|
auditlogs |
shortText |
Common Types
|
No |
0 |
|
Azure Active Directory Identity and Access Activity
|
azureactivedirectoryidentityandaccessactivity |
shortText |
Azure Active Directory Identity and Access (Deprecated)
|
No |
0 |
|
Azure Active Directory Identity and Access Alert Type
|
azureactivedirectoryidentityandaccessalerttype |
shortText |
Azure Active Directory Identity and Access (Deprecated)
|
No |
0 |
|
Azure Active Directory Identity and Access Detected Date Time
|
azureactivedirectoryidentityandaccessdetecteddatetime |
shortText |
Azure Active Directory Identity and Access (Deprecated)
|
No |
0 |
|
Azure Active Directory Identity and Access Detection Timing Type
|
azureactivedirectoryidentityandaccessdetectiontimingtype |
shortText |
Azure Active Directory Identity and Access (Deprecated)
|
No |
0 |
|
Azure Active Directory Identity and Access Token Issuer Type
|
azureactivedirectoryidentityandaccesstokenissuertype |
shortText |
Azure Active Directory Identity and Access (Deprecated)
|
No |
0 |
|
Azure Storage Queue Expiration Time
|
azurestoragequeueexpirationtime |
date |
Azure Storage Queue
|
No |
0 |
|
Azure Storage Queue Insertation Time
|
azurestoragequeueinsertationtime |
date |
Azure Storage Queue
|
No |
0 |
|
Azure Storage Queue Message ID
|
azurestoragequeuemessageid |
shortText |
Azure Storage Queue
|
No |
0 |
|
Azure Storage Queue Message Text
|
azurestoragequeuemessagetext |
longText |
Azure Storage Queue
|
No |
0 |
|
Azure Storage Queue Next Visible Time
|
azurestoragequeuenextvisibletime |
date |
Azure Storage Queue
|
No |
0 |
|
Azure Storage Queue PopReceipt
|
azurestoragequeuepopreceipt |
shortText |
Azure Storage Queue
|
No |
0 |
|
Azure Storage Queue Queue Name
|
azurestoragequeuequeuename |
shortText |
Azure Storage Queue
|
No |
0 |
|
Azure Storage Queue QueueCount
|
azurestoragequeuequeuecount |
number |
Azure Storage Queue
|
No |
0 |
|
AzureDevOps Project ID
|
azuredevopsprojectid |
shortText |
AzureDevOps
|
No |
0 |
|
AzureDevOps Project Name
|
azuredevopsprojectname |
shortText |
AzureDevOps
|
No |
0 |
|
AzureDevOps Pull Request ID
|
azuredevopspullrequestid |
shortText |
AzureDevOps
|
No |
0 |
|
AzureDevOps Repository Name
|
azuredevopsrepositoryname |
shortText |
AzureDevOps
|
No |
0 |
|
AzureDevOps RepositoryID
|
azuredevopsrepositoryid |
shortText |
AzureDevOps
|
No |
0 |
|
AzureDevOps Status
|
azuredevopsstatus |
singleSelect |
AzureDevOps
|
No |
0 |
|
BPA Failed Checks - Anti-Spyware
|
bpafailedchecksantispyware |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
BPA Failed Checks - Anti-Virus
|
bpafailedchecksantivirus |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
BPA Failed Checks - File Blocking
|
bpafailedchecksfileblocking |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
BPA Failed Checks - URL Filtering
|
bpafailedchecksurlfiltering |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
BPA Failed Checks - Vulnerability Protection
|
bpafailedchecksvulnerabilityprotection |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
BPA Failed Checks - WildFire
|
bpafailedcheckswildfire |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
BPA Passed Checks - Anti-Spyware
|
bpapassedchecksantispyware |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
BPA Passed Checks - Anti-Virus
|
bpapassedchecksantivirus |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
BPA Passed Checks - File Blocking
|
bpapassedchecksfileblocking |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
BPA Passed Checks - URL Filtering
|
bpapassedchecksurlfiltering |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
BPA Passed Checks - Vulnerability Protection
|
bpapassedchecksvulnerabilityprotection |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
BPA Passed Checks - WildFire
|
bpapassedcheckswildfire |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Behaviour Objective
|
behaviourobjective |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
Behaviour Scenario
|
behaviourscenario |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
Behaviour Tactic
|
behaviourtactic |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
Best Practices Description
|
bestpracticesdescription |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Birthday
|
birthday |
shortText |
Common Types
|
No |
0 |
|
BitSight Affects Rating
|
bitsightaffectsrating |
shortText |
Bitsight
|
No |
0 |
|
BitSight Assets
|
bitsightassets |
longText |
Bitsight
|
No |
0 |
|
BitSight Comments
|
bitsightcomments |
shortText |
Bitsight
|
No |
0 |
|
BitSight Evidence Key
|
bitsightevidencekey |
shortText |
Bitsight
|
No |
0 |
|
BitSight Related Findings
|
bitsightrelatedfindings |
shortText |
Bitsight
|
No |
0 |
|
BitSight Remaining Decay
|
bitsightremainingdecay |
shortText |
Bitsight
|
No |
0 |
|
BitSight Risk Category
|
bitsightriskcategory |
shortText |
Bitsight
|
No |
0 |
|
BitSight Risk Vector
|
bitsightriskvector |
shortText |
Bitsight
|
No |
0 |
|
BitSight Risk Vector Label
|
bitsightriskvectorlabel |
shortText |
Bitsight
|
No |
0 |
|
BitSight Rolledup Observation Id
|
bitsightrolledupobservationid |
shortText |
Bitsight
|
No |
0 |
|
BitSight Severity Category
|
bitsightseveritycategory |
shortText |
Bitsight
|
No |
0 |
|
BitSight Tags
|
bitsighttags |
tagsSelect |
Bitsight
|
No |
0 |
|
BitSight Temporary Id
|
bitsighttemporaryid |
shortText |
Bitsight
|
No |
0 |
|
Bitsight Affects Rating Reason
|
bitsightaffectsratingreason |
shortText |
Bitsight
|
No |
0 |
|
Bitsight Remediation Status
|
bitsightremediationstatus |
shortText |
Bitsight
|
No |
0 |
|
Block Indicators Status
|
blockindicatorsstatus |
shortText |
Common Types
|
No |
0 |
|
Blocked Action
|
blockedaction |
shortText |
Common Types
|
No |
0 |
|
Bmc Remedyforce Attachment(s)
|
bmcremedyforceattachments |
markdown |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Broadcast
|
bmcremedyforcebroadcast |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Category
|
bmcremedyforcecategory |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Client Account
|
bmcremedyforceclientaccount |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Client Name
|
bmcremedyforceclientname |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Closed Date
|
bmcremedyforcecloseddate |
date |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Configuration Item / Asset
|
bmcremedyforceconfigurationitemasset |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Created Date
|
bmcremedyforcecreateddate |
date |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Description
|
bmcremedyforcedescription |
longText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Due Date
|
bmcremedyforceduedate |
date |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce ID
|
bmcremedyforceid |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Impact
|
bmcremedyforceimpact |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Last Modified Date
|
bmcremedyforcelastmodifieddate |
date |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Note(s)
|
bmcremedyforcenotes |
markdown |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Opened Date
|
bmcremedyforceopeneddate |
date |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Outage End
|
bmcremedyforceoutageend |
date |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Outage Start
|
bmcremedyforceoutagestart |
date |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Queue
|
bmcremedyforcequeue |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Request Definition
|
bmcremedyforcerequestdefinition |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Resolution
|
bmcremedyforceresolution |
longText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Responded Date
|
bmcremedyforcerespondeddate |
date |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Service
|
bmcremedyforceservice |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Service Offering
|
bmcremedyforceserviceoffering |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Service Request
|
bmcremedyforceservicerequest |
markdown |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Staff
|
bmcremedyforcestaff |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Status
|
bmcremedyforcestatus |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Template
|
bmcremedyforcetemplate |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
Bmc Remedyforce Urgency
|
bmcremedyforceurgency |
shortText |
Bmc Helix Remedyforce
|
No |
0 |
|
BmcITSM Assignee
|
bmcassignee |
grid |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM Contact Sensitivity
|
bmcitsmcontactsensitivity |
singleSelect |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM Customer
|
bmccustomer |
grid |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM Display ID
|
bmcdisplayid |
shortText |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM Impact
|
bmcitsmimpact |
singleSelect |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM Reason For Change
|
bmcitsmreasonforchange |
shortText |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM Request ID
|
bmcrequestid |
shortText |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM Requester
|
bmcrequester |
grid |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM Risk Level
|
bmcitsmrisklevel |
singleSelect |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM Status Reason
|
bmcitsmstatusreason |
singleSelect |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM Sub-Type
|
bmcsubtype |
shortText |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM Submitter
|
bmcsubmitter |
shortText |
BMC Helix ITSM
|
No |
0 |
|
BmcITSM VIP Flag
|
bmcitsmvipflag |
singleSelect |
BMC Helix ITSM
|
No |
0 |
|
Box Source Created By ID
|
boxsourcecreatedbyid |
shortText |
Box
|
No |
0 |
|
Box Source Created By Name
|
boxsourcecreatedbyname |
shortText |
Box
|
No |
0 |
|
Box Source Owner ID
|
boxsourceownerid |
shortText |
Box
|
No |
0 |
|
Box Source Owner Name
|
boxsourceownername |
shortText |
Box
|
No |
0 |
|
Box Source Parent ID
|
boxsourceparentid |
shortText |
Box
|
No |
0 |
|
Box Source Parent Name
|
boxsourceparentname |
shortText |
Box
|
No |
0 |
|
Branch Name
|
branchname |
shortText |
XSOAR CI/CD
|
No |
0 |
|
Breach Confirmation
|
breachconfirmation |
singleSelect |
Common Scripts
|
No |
0 |
|
Bugtraq
|
bugtraq |
shortText |
Common Types
|
No |
0 |
|
CAF A Achievement
|
cafaachievement |
singleSelect |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF A Answers
|
cafaanswers |
longText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF A Details
|
cafadetails |
markdown |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF A Email
|
cafaemail |
shortText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF A Questions
|
cafaquestions |
longText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF A Result
|
cafaresult |
markdown |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF A Result Raw
|
cafaresultraw |
shortText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF A Status
|
cafastatus |
singleSelect |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF B Achievement
|
cafbachievement |
singleSelect |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF B Answers
|
cafbanswers |
longText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF B Details
|
cafbdetails |
markdown |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF B Email
|
cafbemail |
shortText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF B Questions
|
cafbquestions |
longText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF B Result
|
cafbresult |
markdown |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF B Result Raw
|
cafbresultraw |
shortText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF B Status
|
cafbstatus |
singleSelect |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF C Achievement
|
cafcachievement |
singleSelect |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF C Answers
|
cafcanswers |
longText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF C Details
|
cafcdetails |
markdown |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF C Email
|
cafcemail |
shortText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF C Questions
|
cafcquestions |
longText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF C Result
|
cafcresult |
markdown |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF C Result Raw
|
cafcresultraw |
shortText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF C Status
|
cafcstatus |
singleSelect |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF D Achievement
|
cafdachievement |
singleSelect |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF D Answers
|
cafdanswers |
longText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF D Details
|
cafddetails |
markdown |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF D Email
|
cafdemail |
shortText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF D Questions
|
cafdquestions |
longText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF D Result
|
cafdresult |
markdown |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF D Result Raw
|
cafdresultraw |
shortText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF D Status
|
cafdstatus |
singleSelect |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF Overall Result
|
cafoverallresult |
singleSelect |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CAF Regulator Email
|
cafregulatoremail |
shortText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
CGO CMD
|
cgocmd |
multiSelect |
Core Alert Fields
|
No |
0 |
|
CGO MD5
|
cgomd5 |
multiSelect |
Core Alert Fields
|
No |
0 |
|
CGO SHA256
|
cgosha256 |
multiSelect |
Core Alert Fields
|
No |
0 |
|
CGO name
|
cgoname |
multiSelect |
Core Alert Fields
|
No |
0 |
|
CGO path
|
cgopath |
multiSelect |
Core Alert Fields
|
No |
0 |
|
CGO signature
|
cgosignature |
multiSelect |
Core Alert Fields
|
No |
0 |
|
CGO signer
|
cgosigner |
multiSelect |
Core Alert Fields
|
No |
0 |
|
CI/CD Branch
|
cicdbranch |
shortText |
XSOAR CI/CD
|
No |
0 |
|
CI/CD Keep Placeholders In Files
|
cicdkeepplaceholdersinfiles |
boolean |
XSOAR CI/CD
|
No |
0 |
|
CI/CD Pack Name
|
cicdpackname |
shortText |
XSOAR CI/CD
|
No |
0 |
|
CI/CD Pull Request Attachment
|
cicdpullrequestattachment |
attachments |
XSOAR CI/CD
|
No |
0 |
|
CI/CD Pull Request Branch
|
cicdpullrequestbranch |
singleSelect |
XSOAR CI/CD
|
No |
0 |
|
CI/CD Pull Request Comment
|
cicdpullrequestcomment |
longText |
XSOAR CI/CD
|
No |
0 |
|
CI/CD Pull Request Link
|
cicdpullrequestlink |
url |
XSOAR CI/CD
|
No |
0 |
|
CI/CD Pull Request Review
|
cicdpullrequestreview |
longText |
XSOAR CI/CD
|
No |
0 |
|
CI/CD Pull Request Reviewer
|
cicdreviewer |
shortText |
XSOAR CI/CD
|
No |
0 |
|
CI/CD Pull Request Title
|
cicdpullrequesttitle |
shortText |
XSOAR CI/CD
|
No |
0 |
|
CI/CD S3 Bucket Name
|
cicds3bucketname |
shortText |
XSOAR CI/CD
|
No |
0 |
|
CICD Azure DevOps target ref
|
cicdazuredevopstargetref |
shortText |
XSOAR CI/CD
|
No |
0 |
|
CID
|
cid |
multiSelect |
Core Alert Fields
|
No |
0 |
|
CMD
|
cmd |
multiSelect |
Common Types
|
No |
0 |
|
CMD line
|
cmdline |
multiSelect |
Common Types
|
No |
0 |
|
CRYPTOSIM Category ID
|
cryptosimcategoryid |
number |
Cryptosim
|
No |
0 |
|
CRYPTOSIM Correlation ID
|
cryptosimcorrelationid |
number |
Cryptosim
|
No |
0 |
|
CRYPTOSIM Event Start Date
|
cryptosimeventstartdate |
shortText |
Cryptosim
|
No |
0 |
|
CRYPTOSIM Log Date
|
cryptosimlogdate |
shortText |
Cryptosim
|
No |
0 |
|
CRYPTOSIM Log Type
|
cryptosimlogtype |
shortText |
Cryptosim
|
No |
0 |
|
CRYPTOSIM Plugin ID
|
cryptosimpluginid |
number |
Cryptosim
|
No |
0 |
|
CTF01
Hidden
|
ctf01 |
timer |
Capture The Flag - 01
|
No |
0 |
|
CTF02
|
ctf02 |
timer |
Capture The Flag - 02
|
No |
0 |
|
CTIX Custom Attributes
|
ctixcustomattributes |
longText |
Cyware Intel Exchange
|
No |
0 |
|
CTIX Custom Scores
|
ctixcustomscores |
longText |
Cyware Intel Exchange
|
No |
0 |
|
CTIX Relations
|
ctixrelations |
longText |
Cyware Intel Exchange
|
No |
0 |
|
CTM360 CyberBlindspot BC Breach Source
|
ctm360cyberblindspotbcbreachsource |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot BC Domain
|
ctm360cyberblindspotbcdomain |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot BC Email
|
ctm360cyberblindspotbcemail |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot BC Executive Name
|
ctm360cyberblindspotbcexecutivename |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot BC Password
|
ctm360cyberblindspotbcpassword |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot BC Username
|
ctm360cyberblindspotbcusername |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Brand
|
ctm360cyberblindspotbrand |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot CC CVV
|
ctm360cyberblindspotcccvv |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot CC Card Number
|
ctm360cyberblindspotcccardnumber |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot CC Expiry Month
|
ctm360cyberblindspotccexpirymonth |
number |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot CC Expiry Year
|
ctm360cyberblindspotccexpiryyear |
number |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Class
|
ctm360cyberblindspotclass |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Confirmation Time
|
ctm360cyberblindspotconfirmationtime |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Course of Action
|
ctm360cyberblindspotcourseofaction |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot First Seen
|
ctm360cyberblindspotfirstseen |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Incident Type
|
ctm360cyberblindspottype |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Last Seen
|
ctm360cyberblindspotlastseen |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Computer Name
|
ctm360cyberblindspotmlcomputername |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Date Compromised
|
ctm360cyberblindspotmldatecompromised |
date |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Domain
|
ctm360cyberblindspotmldomain |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Hostname
|
ctm360cyberblindspotmlhostname |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Malware Path
|
ctm360cyberblindspotmlmalwarepath |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Masked Password
|
ctm360cyberblindspotmlmaskedpassword |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Operating System
|
ctm360cyberblindspotmloperatingsystem |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Password
|
ctm360cyberblindspotmlpassword |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Software
|
ctm360cyberblindspotmlsoftware |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Source URI
|
ctm360cyberblindspotmlsourceuri |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Sources
|
ctm360cyberblindspotmlsources |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Stealer Family
|
ctm360cyberblindspotmlstealerfamily |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML URL Path
|
ctm360cyberblindspotmlurlpath |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML User
|
ctm360cyberblindspotmluser |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML User Domain
|
ctm360cyberblindspotmluserdomain |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot ML Website
|
ctm360cyberblindspotmlwebsite |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Module
|
ctm360cyberblindspotmodule |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Remarks
|
ctm360cyberblindspotremarks |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Risks
|
ctm360cyberblindspotrisks |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Screenshots
|
ctm360cyberblindspotscreenshots |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Severity
|
ctm360cyberblindspotseverity |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Status
|
ctm360cyberblindspotstatus |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Subject
|
ctm360cyberblindspotsubject |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Ticket ID
|
ctm360cyberblindspotticketid |
shortText |
CTM360
|
No |
0 |
|
CTM360 CyberBlindspot Timestamp
|
ctm360cyberblindspottimestamp |
shortText |
CTM360
|
No |
0 |
|
CTM360 HackerView Asset Type
|
ctm360hackerviewassettype |
shortText |
CTM360
|
No |
0 |
|
CTM360 HackerView Potential Attack Types
|
ctm360hackerviewpotentialattack |
multiSelect |
CTM360
|
No |
0 |
|
CTM360 HackerView Potential Impact
|
ctm360hackerviewpotentialimpact |
multiSelect |
CTM360
|
No |
0 |
|
CTM360 HackerView Technologies
|
ctm360hackerviewtechnologies |
multiSelect |
CTM360
|
No |
0 |
|
CVE
|
cve |
shortText |
Common Types
|
No |
0 |
|
CVE Description
|
cvedescription |
shortText |
Use Case Builder
|
No |
0 |
|
CVE ID
|
cveid |
shortText |
Common Types
|
No |
0 |
|
CVE List
|
cvelist |
shortText |
PAN-OS by Palo Alto Networks
|
No |
0 |
|
CVE Published
|
cvepublished |
shortText |
Common Types
|
No |
0 |
|
CVE Reference Links
|
cvereferencelinks |
url |
Use Case Builder
|
No |
0 |
|
CVE Score
|
cvescore |
shortText |
Use Case Builder
|
No |
0 |
|
CVSS
|
cvss |
shortText |
Common Types
|
No |
0 |
|
CVSS Availability Requirement
|
cvssavailabilityrequirement |
multiSelect |
Common Types
|
No |
0 |
|
CVSS Collateral Damage Potential
|
cvsscollateraldamagepotential |
multiSelect |
Common Types
|
No |
0 |
|
CVSS Confidentiality Requirement
|
cvssconfidentialityrequirement |
multiSelect |
Common Types
|
No |
0 |
|
CVSS Integrity Requirement
|
cvssintegrityrequirement |
multiSelect |
Common Types
|
No |
0 |
|
Caller
|
caller |
shortText |
Common Types
|
No |
0 |
|
Campaign Close Notes
|
campaignclosenotes |
longText |
Phishing Campaign
|
No |
0 |
|
Campaign Email Body
|
campaignemailbody |
longText |
Phishing Campaign
|
No |
0 |
|
Campaign Email Sender Instance
|
campaignemailsenderinstance |
singleSelect |
Phishing Campaign
|
No |
0 |
|
Campaign Email Subject
|
campaignemailsubject |
shortText |
Phishing Campaign
|
No |
0 |
|
Campaign Email To
|
campaignemailto |
shortText |
Phishing Campaign
|
No |
0 |
|
Campaign Mutual Indicators
|
campaignmutualindicators |
markdown |
Phishing Campaign
|
No |
0 |
|
Campaign Name
|
campaignname |
markdown |
Common Types
|
No |
0 |
|
Campaign to hunt
|
campaigntohunt |
shortText |
Proactive Threat Hunting
|
No |
0 |
|
Carbon Black EDR IOC Value
|
carbonblackedriocvalue |
shortText |
Carbon Black Enterprise Response
|
No |
0 |
|
Carbon Black EDR Segment ID
|
carbonblackedrsegmentid |
shortText |
Carbon Black Enterprise Response
|
No |
0 |
|
Carbon Black EDR Unique ID
|
carbonblackedruniqueid |
shortText |
Carbon Black Common Fields
|
No |
0 |
|
Carbon Black EDR Watchlist Id
|
carbonblackedrwatchlistid |
shortText |
Carbon Black Enterprise Response
|
No |
0 |
|
Carbon Black EDR Watchlist Name
|
carbonblackedrwatchlistname |
shortText |
Carbon Black Enterprise Response
|
No |
0 |
|
Carbon Black ES Alert Severity
|
carbonblackesalertseverity |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES First Event Time
|
carbonblackesfirsteventtime |
date |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES IOC Hit
|
carbonblackesiochit |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES IOC Id
|
carbonblackesiocid |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES Last Event Time
|
carbonblackeslasteventtime |
date |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES Process Id
|
carbonblackesprocessid |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES Process Name
|
carbonblackesprocessname |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES Report ID
|
carbonblackesreportid |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES Report Name
|
carbonblackesreportname |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES Reputation
|
carbonblackesreputation |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES Target Value
|
carbonblackestargetvalue |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES Threat Category
|
carbonblackesthreatcategory |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES Threat Id
|
carbonblackesthreatid |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Carbon Black ES Vector
|
carbonblackesvector |
shortText |
Carbon Black Endpoint Standard
|
No |
0 |
|
Categories
|
categories |
multiSelect |
Common Types
|
No |
0 |
|
Category Count
|
categorycount |
number |
Common Types
|
No |
0 |
|
Category Name
|
categoryname |
shortText |
Core Alert Fields
|
No |
0 |
|
CertStream Certificate Index
|
certstreamcertificateindex |
number |
CertStream
|
No |
0 |
|
CertStream Certificate Source
|
certstreamcertificatesource |
shortText |
CertStream
|
No |
0 |
|
CertStream Domain Registrar Abuse Email
|
certstreamdomainregistrarabuseemail |
shortText |
CertStream
|
No |
0 |
|
CertStream Fingerprint
|
certstreamfingerprint |
shortText |
CertStream
|
No |
0 |
|
CertStream Levenshtein distance
|
certstreamlevenshteindistance |
number |
CertStream
|
No |
0 |
|
CertStream User asset
|
certstreamuserasset |
shortText |
CertStream
|
No |
0 |
|
Changed
|
changed |
shortText |
Common Types
|
No |
0 |
|
Cheat Sheet
|
cheatsheet |
markdown |
Proactive Threat Hunting
|
No |
0 |
|
Check ID
|
checkid |
shortText |
Nutanix Hypervisor
|
No |
0 |
|
CheckPointHEC Campaign Task
|
checkpointheccampaigntask |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Customer
|
checkpointheccustomer |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Email Info
|
checkpointhecemailinfo |
markdown |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Email Sender
|
checkpointhecemailsender |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Email Subject
|
checkpointhecemailsubject |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Email Task
|
checkpointhecemailtask |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Entity
|
checkpointhecentity |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Farm
|
checkpointhecfarm |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Parent
|
checkpointhecparent |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Request Child
|
checkpointhecrequestchild |
boolean |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Request Comment
|
checkpointhecrequestcomment |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Request Time
|
checkpointhecrequesttime |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Saas
|
checkpointhecsaas |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Scan Info
|
checkpointhecscaninfo |
longText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointHEC Type
|
checkpointhectype |
shortText |
Check Point Harmony Email and Collaboration (HEC)
|
No |
0 |
|
CheckPointNDR Application Names
|
appiname |
multiSelect |
Check Point Infinity NDR
|
No |
0 |
|
CheckPointNDR Received Bytes
|
receivedbytes |
number |
Check Point Infinity NDR
|
No |
0 |
|
CheckPointNDR Sent Bytes
|
sentbytes |
number |
Check Point Infinity NDR
|
No |
0 |
|
Child Process
|
childprocess |
multiSelect |
Common Types
|
No |
0 |
|
Choke points
|
chokepoints |
shortText |
XM Cyber
|
No |
0 |
|
Choose SDO To Hunt for
|
choosesdotohuntfor |
shortText |
Proactive Threat Hunting
|
No |
0 |
|
Chronicle Alert Count
|
chroniclealertcount |
shortText |
Google SecOps
|
No |
0 |
|
Chronicle Alert Name
|
chroniclealertname |
shortText |
Google SecOps
|
No |
0 |
|
Chronicle Auto Block Entities
|
chronicleautoblockentities |
singleSelect |
Google SecOps
|
No |
0 |
|
Chronicle Curated Events
|
chroniclecuratedevents |
grid |
Google SecOps
|
No |
0 |
|
Chronicle DBot Score
|
chronicledbotscore |
number |
Google SecOps
|
No |
0 |
|
Chronicle Detection Created Time
|
chronicledetectioncreatedtime |
date |
Google SecOps
|
No |
0 |
|
Chronicle Detection ID
|
chronicledetectionid |
shortText |
Google SecOps
|
No |
0 |
|
Chronicle Detection State
|
chronicledetectionstate |
singleSelect |
Google SecOps
|
No |
0 |
|
Chronicle Detection Time
|
chronicledetectiontime |
date |
Google SecOps
|
No |
0 |
|
Chronicle Detection Type
|
chronicledetectiontype |
shortText |
Google SecOps
|
No |
0 |
|
Chronicle Detection Window End Time
|
chronicledetectionwindowendtime |
date |
Google SecOps
|
No |
0 |
|
Chronicle Detection Window Start Time
|
chronicledetectionwindowstarttime |
date |
Google SecOps
|
No |
0 |
|
Chronicle Domain Name
|
chronicledomainname |
shortText |
Google SecOps
|
No |
0 |
|
Chronicle Events
|
chronicleevents |
grid |
Google SecOps
|
No |
0 |
|
Chronicle First Seen
|
chroniclefirstseen |
date |
Google SecOps
|
No |
0 |
|
Chronicle IOC Ingest Time
|
chronicleiocingesttime |
date |
Google SecOps
|
No |
0 |
|
Chronicle Last Seen
|
chroniclelastseen |
date |
Google SecOps
|
No |
0 |
|
Chronicle Rule ID
|
chronicleruleid |
shortText |
Google SecOps
|
No |
0 |
|
Chronicle Rule Name
|
chroniclerulename |
shortText |
Google SecOps
|
No |
0 |
|
Chronicle Rule Type
|
chronicleruletype |
singleSelect |
Google SecOps
|
No |
0 |
|
Chronicle Rule Version
|
chronicleruleversion |
shortText |
Google SecOps
|
No |
0 |
|
Chronicle Skip Entity Isolation
|
chronicleskipentityisolation |
singleSelect |
Google SecOps
|
No |
0 |
|
Chronicle Source Product
|
chroniclesourceproduct |
shortText |
Google SecOps
|
No |
0 |
|
Chronicle User
|
chronicleuser |
shortText |
Google SecOps
|
No |
0 |
|
ChronicleAsset Support Contact
|
chronicleassetsupportcontact |
shortText |
Google SecOps
|
No |
0 |
|
CiscoESA Attachments
|
ciscoesaattachments |
shortText |
Cisco Email Security Appliance (IronPort)
|
No |
0 |
|
CiscoSMA Attachments
|
ciscosmaattachments |
shortText |
CiscoSMA
|
No |
0 |
|
City
|
city |
shortText |
Common Types
|
No |
0 |
|
Claroty Alert Resolved
|
clarotyalertresolved |
boolean |
Claroty
|
No |
0 |
|
Claroty Alert Type
|
clarotyalerttype |
shortText |
Claroty
|
No |
0 |
|
Claroty Category
|
clarotycategory |
shortText |
Claroty
|
No |
0 |
|
Claroty Network ID
|
clarotynetworkid |
shortText |
Claroty
|
No |
0 |
|
Claroty Related Assets
|
clarotyrelatedassets |
grid |
Claroty
|
No |
0 |
|
Claroty Resource ID
|
clarotyresourceid |
shortText |
Claroty
|
No |
0 |
|
Claroty Site ID
|
clarotysiteid |
shortText |
Claroty
|
No |
0 |
|
Claroty xDome Alert Assignees
|
clarotyxdomealertassignees |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Alert Class
|
clarotyxdomealertclass |
shortText |
Claroty xDome
|
No |
0 |
|
Claroty xDome Alert Description
|
clarotyxdomealertdescription |
shortText |
Claroty xDome
|
No |
0 |
|
Claroty xDome Alert Labels
|
clarotyxdomealertlabels |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Alert Type
|
clarotyxdomealerttype |
shortText |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Assignees
|
clarotyxdomedeviceassignees |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Category
|
clarotyxdomedevicecategory |
shortText |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Effective Likelihood Subscore
|
clarotyxdomedeviceeffectivelikelihoodsubscore |
singleSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Effective Likelihood Subscore Points
|
clarotyxdomedeviceeffectivelikelihoodsubscorepoints |
number |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device First Seen
|
clarotyxdomedevicefirstseen |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device IP
|
clarotyxdomedeviceip |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Impact Subscore
|
clarotyxdomedeviceimpactsubscore |
singleSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Impact Subscore Points
|
clarotyxdomedeviceimpactsubscorepoints |
number |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Insecure Protocols
|
clarotyxdomedeviceinsecureprotocols |
singleSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Insecure Protocols Points
|
clarotyxdomedeviceinsecureprotocolspoints |
number |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Internet Communication
|
clarotyxdomedeviceinternetcommunication |
shortText |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Known Vulnerabilities
|
clarotyxdomedeviceknownvulnerabilities |
singleSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Known Vulnerabilities Points
|
clarotyxdomedeviceknownvulnerabilitiespoints |
number |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Labels
|
clarotyxdomedevicelabels |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Last Seen
|
clarotyxdomedevicelastseen |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Likelihood Subscore
|
clarotyxdomedevicelikelihoodsubscore |
singleSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Likelihood Subscore Points
|
clarotyxdomedevicelikelihoodsubscorepoints |
number |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device MAC
|
clarotyxdomedevicemac |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Manufacturer
|
clarotyxdomedevicemanufacturer |
shortText |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Network
|
clarotyxdomedevicenetwork |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Purdue Level
|
clarotyxdomedevicepurduelevel |
shortText |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Risk Score
|
clarotyxdomedeviceriskscore |
singleSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Risk Score Points
|
clarotyxdomedeviceriskscorepoints |
number |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Site Name
|
clarotyxdomedevicesitename |
shortText |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Subcategory
|
clarotyxdomedevicesubcategory |
shortText |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device Type
|
clarotyxdomedevicetype |
shortText |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device-Alert Detected Time
|
clarotyxdomedevicealertdetectedtime |
date |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device-Alert Status
|
clarotyxdomedevicealertstatus |
singleSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Device-Alert Updated Time
|
clarotyxdomedevicealertupdatedtime |
date |
Claroty xDome
|
No |
0 |
|
Claroty xDome Mitre Technique Enterprise IDs
|
clarotyxdomemitretechniqueenterpriseids |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Mitre Technique Enterprise Names
|
clarotyxdomemitretechniqueenterprisenames |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Mitre Technique ICS IDs
|
clarotyxdomemitretechniqueicsids |
multiSelect |
Claroty xDome
|
No |
0 |
|
Claroty xDome Mitre Technique ICS Names
|
clarotyxdomemitretechniqueicsnames |
multiSelect |
Claroty xDome
|
No |
0 |
|
Classification
|
classification |
shortText |
Common Types
|
No |
0 |
|
Classifications
|
classifications |
shortText |
Nutanix Hypervisor
|
No |
0 |
|
Clicked URLs
|
clickedurls |
grid |
Phishing
|
No |
0 |
|
Close Time
|
closetime |
shortText |
Common Types
|
No |
0 |
|
Closing Reason
|
closingreason |
shortText |
Common Types
|
No |
0 |
|
Closing User
|
closinguser |
shortText |
Common Types
|
No |
0 |
|
Cloud Account ID
|
cloudaccountid |
multiSelect |
Common Types
|
No |
0 |
|
Cloud Identity Sub Type
|
cloudidentitysubtype |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Cloud Identity Type
|
cloudidentitytype |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Cloud Instance ID
|
cloudinstanceid |
multiSelect |
Common Types
|
No |
0 |
|
Cloud Operation Type
|
cloudoperationtype |
multiSelect |
Common Types
|
No |
0 |
|
Cloud Operation Type
|
cloudoperationtype |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Cloud Project
|
cloudproject |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Cloud Provider
|
cloudprovider |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Cloud Referenced Resource
|
cloudreferencedresource |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Cloud Region List
|
cloudregionlist |
multiSelect |
Common Types
|
No |
0 |
|
Cloud Resource List
|
cloudresourcelist |
multiSelect |
Common Types
|
No |
0 |
|
Cloud Resource Sub-type
|
cloudresourcesubtype |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Cloud Resource Type
|
cloudresourcetype |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Cloud Service
|
cloudservice |
number |
Common Types
|
No |
0 |
|
Cluster Name
|
clustername |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Cluster UUID
|
clusteruuid |
shortText |
Nutanix Hypervisor
|
No |
0 |
|
Code42 Alert ID
|
code42alertid |
shortText |
Code42
|
No |
0 |
|
Code42 Alert Risk Severity Summary
|
code42alertriskseveritysummary |
shortText |
Code42
|
No |
0 |
|
Code42 Alert Type
|
code42alerttype |
shortText |
Code42
|
No |
0 |
|
Code42 Alert URL
|
code42alerturl |
url |
Code42
|
No |
0 |
|
Code42 File Events
|
code42fileevents |
grid |
Code42
|
No |
0 |
|
Code42 File Events Version
|
code42fileeventsversion |
shortText |
Code42
|
No |
0 |
|
Code42 SecurityAlert Description
|
code42alertdescription |
shortText |
Code42
|
No |
0 |
|
Code42 SecurityAlert Name
|
code42alertname |
shortText |
Code42
|
No |
0 |
|
Code42 SecurityAlert State
|
code42alertstate |
shortText |
Code42
|
No |
0 |
|
Code42 SecurityAlert Timestamp
|
code42alerttimestamp |
date |
Code42
|
No |
0 |
|
Code42 Severity
|
code42severity |
shortText |
Code42
|
No |
0 |
|
Code42 Username
|
code42username |
shortText |
Code42
|
No |
0 |
|
Cofense Triage Report Attachment Information
|
cofensetriagereportattachmentinformation |
grid |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Categorization Tags
|
cofensetriagereportcategorizationtags |
shortText |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Category ID
|
cofensetriagereportcategoryid |
shortText |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Created At
|
cofensetriagereportcreatedat |
date |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report From Address
|
cofensetriagereportfromaddress |
shortText |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report ID
|
cofensetriagereportid |
shortText |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Location
|
cofensetriagereportlocation |
shortText |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report MD5
|
cofensetriagereportmd5 |
shortText |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Match Priority
|
cofensetriagereportmatchpriority |
number |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Processed At
|
cofensetriagereportprocessedat |
date |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Received At
|
cofensetriagereportreceivedat |
date |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Reported At
|
cofensetriagereportreportedat |
date |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Risk Score
|
cofensetriagereportriskscore |
number |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report SHA256
|
cofensetriagereportsha256 |
shortText |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Subject
|
cofensetriagereportsubject |
shortText |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Tags
|
cofensetriagereporttags |
shortText |
Cofense Triage
|
No |
0 |
|
Cofense Triage Report Updated At
|
cofensetriagereportupdatedat |
date |
Cofense Triage
|
No |
0 |
|
Cohesity Helios Alert Cause
|
cohesityheliosalertcause |
longText |
Cohesity Helios
|
No |
0 |
|
Cohesity Helios Alert Description
|
cohesityheliosalertdescription |
longText |
Cohesity Helios
|
No |
0 |
|
Cohesity Helios Alert Id
|
cohesityheliosalertid |
shortText |
Cohesity Helios
|
No |
0 |
|
Cohesity Helios Anomalous Object Name
|
cohesityheliosanomalousobjectname |
shortText |
Cohesity Helios
|
No |
0 |
|
Cohesity Helios Anomaly Strength
|
cohesityheliosanomalystrength |
number |
Cohesity Helios
|
No |
0 |
|
Cohesity Helios Cluster Id
|
cohesityheliosclusterid |
number |
Cohesity Helios
|
No |
0 |
|
Cohesity Helios Cluster Name
|
cohesityheliosclustername |
shortText |
Cohesity Helios
|
No |
0 |
|
Cohesity Helios Object Environment
|
cohesityheliosobjectenvironment |
shortText |
Cohesity Helios
|
No |
0 |
|
Cohesity Helios Object Id
|
cohesityheliosobjectid |
shortText |
Cohesity Helios
|
No |
0 |
|
Collection Remediation Products
|
collectionremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Command Line
|
commandline |
shortText |
Common Types
|
No |
0 |
|
Command Line Verdict
|
commandlineverdict |
shortText |
Common Types
|
No |
0 |
|
Command and Control Remediation Products
|
commandandcontrolremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Comment
|
comment |
shortText |
Common Types
|
No |
0 |
|
Commvault Affected Files Count
|
commvaultaffectedfilescount |
shortText |
Commvault Cloud
|
No |
0 |
|
Commvault Created Files Count
|
commvaultcreatedfilescount |
shortText |
Commvault Cloud
|
No |
0 |
|
Commvault Deleted Files Count
|
commvaultdeletedfilescount |
shortText |
Commvault Cloud
|
No |
0 |
|
Commvault Event Time
|
commvaulteventtime |
shortText |
Commvault Cloud
|
No |
0 |
|
Commvault Files List
|
commvaultfileslist |
grid |
Commvault Cloud
|
No |
0 |
|
Commvault Job Id
|
commvaultjobid |
number |
Commvault Cloud
|
No |
0 |
|
Commvault Modified Files Count
|
commvaultmodifiedfilescount |
shortText |
Commvault Cloud
|
No |
0 |
|
Commvault Originating Client
|
commvaultoriginatingclient |
shortText |
Commvault Cloud
|
No |
0 |
|
Commvault Originating Program
|
commvaultoriginatingprogram |
shortText |
Commvault Cloud
|
No |
0 |
|
Commvault Renamed Files Count
|
commvaultrenamedfilescount |
shortText |
Commvault Cloud
|
No |
0 |
|
Commvault Scanned Folder List
|
commvaultscannedfolderlist |
multiSelect |
Commvault Cloud
|
No |
0 |
|
Company Address
|
companyaddress |
shortText |
Common Scripts
|
No |
0 |
|
Company City
|
companycity |
shortText |
Common Scripts
|
No |
0 |
|
Company Country
|
companycountry |
shortText |
Common Scripts
|
No |
0 |
|
Company Name
|
companyname |
shortText |
Common Scripts
|
No |
0 |
|
Company Postal Code
|
companypostalcode |
shortText |
Common Scripts
|
No |
0 |
|
Company Property Status
|
companypropertystatus |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Company has Insurance for the Breach
|
companyhasinsuranceforthebreach |
shortText |
Common Scripts
|
No |
0 |
|
Completed Task Count
|
completedtaskcount |
shortText |
Rapid Breach Response
|
No |
0 |
|
Compliance Notes
|
compliancenotes |
multiSelect |
Common Types
|
No |
0 |
|
Compromising Techniques
|
compromisingtechniques |
grid |
XM Cyber
|
No |
0 |
|
Configuration File Path
|
configfilepath |
shortText |
XSOAR CI/CD
|
No |
0 |
|
Configuration File Source
|
configurationfilesource |
singleSelect |
XSOAR CI/CD
|
No |
0 |
|
Consumer Reporting Agencies Notification
|
consumerreportingagenciesnotification |
singleSelect |
Common Scripts
|
No |
0 |
|
Contact Address
|
contactaddress |
shortText |
Common Scripts
|
No |
0 |
|
Contact Email address
|
contactemailaddress |
shortText |
Common Scripts
|
No |
0 |
|
Contact Name
|
contactname |
shortText |
Common Scripts
|
No |
0 |
|
Contact Telephone number
|
contacttelephonenumber |
shortText |
Common Scripts
|
No |
0 |
|
Container ID
|
containerid |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Containment SLA
|
containmentsla |
timer |
Common Types
|
No |
0 |
|
Contains Featured Host
|
containsfeaturedhost |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Contains Featured IP Address
|
containsfeaturedipaddress |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Contains Featured User
|
containsfeatureduser |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Content Notification Email
|
contentnotificationemail |
shortText |
XSOAR Content Update Notifications
|
No |
0 |
|
Content Notification Slack Channel
|
contentnotificationslackchannel |
shortText |
XSOAR Content Update Notifications
|
No |
0 |
|
Content Notification Slack Channel ID
|
contentnotificationslackchannelid |
shortText |
XSOAR Content Update Notifications
|
No |
0 |
|
Content Notification Slack Username
|
contentnotificationslackusername |
shortText |
XSOAR Content Update Notifications
|
No |
0 |
|
Content Pack Selection
|
contentpackselection |
longText |
XSOAR Content Update Notifications
|
No |
0 |
|
Content Testing Commit History
|
contenttestingcommithistory |
markdown |
Content Testing
|
No |
0 |
|
Content Testing Content Automations
|
contenttestingcontentautomations |
markdown |
Content Testing
|
No |
0 |
|
Content Testing Content Details
|
contenttestingcontentdetails |
markdown |
Content Testing
|
No |
0 |
|
Content Testing Content Impacts
|
contenttestingcontentimpacts |
markdown |
Content Testing
|
No |
0 |
|
Content Testing Coverage
|
contenttestingcoverage |
markdown |
Content Testing
|
No |
0 |
|
Content Testing Dependencies
|
contenttestingdependencies |
markdown |
Content Testing
|
No |
0 |
|
Content Testing PBA Info
|
contenttestingpbainfo |
markdown |
Content Testing
|
No |
0 |
|
Content Testing Unit Test Help
|
contenttestingunittesthelp |
markdown |
Content Testing
|
No |
0 |
|
Content Testing Unit Test Playbooks
|
contenttestingunittestplaybooks |
multiSelect |
Content Testing
|
No |
0 |
|
Content Testing UnitTestResults
|
contenttestingunittestresults |
grid |
Content Testing
|
No |
0 |
|
Content Updates Auto Install
|
contentupdatesautoinstall |
boolean |
XSOAR Content Update Notifications
|
No |
0 |
|
Content Updates Available
|
contentupdatesavailable |
markdown |
XSOAR Content Update Notifications
|
No |
0 |
|
Coordinates
|
coordinates |
shortText |
Impossible Traveler
|
No |
0 |
|
Cost Center
|
costcenter |
shortText |
Common Types
|
No |
0 |
|
Cost Center Code
|
costcentercode |
shortText |
Common Types
|
No |
0 |
|
Country
|
country |
shortText |
Common Types
|
No |
0 |
|
Country
|
country |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Country Code
|
countrycode |
shortText |
Common Types
|
No |
0 |
|
Country Code Number
|
countrycodenumber |
shortText |
Common Types
|
No |
0 |
|
Country Name
|
countryname |
shortText |
Common Types
|
No |
0 |
|
Country where business has its main establishment
|
countrywherebusinesshasitsmainestablishment |
shortText |
Common Scripts
|
No |
0 |
|
Country where the breach took place
|
countrywherethebreachtookplace |
shortText |
Common Scripts
|
No |
0 |
|
Created Date Failed Incidents
|
createddatefailedincidents |
multiSelect |
Integrations & Incidents Health Check
|
No |
0 |
|
Created Time
|
createdtime |
shortText |
Atlassian Jira
|
No |
0 |
|
Credential Access Remediation Products
|
credentialaccessremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Credibility - Offense
|
credibilityoffense |
number |
IBM QRadar
|
No |
0 |
|
Critical Assets
|
criticalassets |
grid |
Common Types
|
No |
0 |
|
Critical Assets at Risk Level
|
criticalassetsatrisklevel |
shortText |
XM Cyber
|
No |
0 |
|
Critical Assets at Risk List
|
criticalassetsatrisklist |
grid |
XM Cyber
|
No |
0 |
|
Critical assets at risk
|
criticalassetsatrisk |
number |
XM Cyber
|
No |
0 |
|
CrowdStrike Falcon Actor slug
|
crowdstrikefalconactorslug |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Alleged File Type
|
crowdstrikefalconallegedfiletype |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon At Accounts
|
crowdstrikefalconataccounts |
multiSelect |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Behaviour Pattern Disposition Details
|
crowdstrikefalconbehaviourpatterndispositiondetails |
grid |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Bios Manufacturer
|
crowdstrikefalconbiosmanufacturer |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Bios Version
|
crowdstrikefalconbiosversion |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Crawled Timestamp
|
crowdstrikefalconcrawledtimestamp |
date |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Data Domains
|
crowdstrikefalcondatadomains |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Detection Type
|
crowdstrikefalcondetectiontype |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Enrichments
|
crowdstrikefalconenrichments |
longText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Firmware Build Fingerprint
|
crowdstrikefalconfirmwarebuildfingerprint |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Firmware Build Time
|
crowdstrikefalconfirmwarebuildtime |
date |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon IOC CVES
|
crowdstrikefalconioccves |
multiSelect |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon IOC Domains
|
crowdstrikefalconiocdomains |
multiSelect |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon IOC Emails
|
crowdstrikefalconiocemails |
multiSelect |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon IOC Hashtags
|
crowdstrikefalconiochashtags |
multiSelect |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon IOC Types
|
crowdstrikefalconioctypes |
multiSelect |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon IOC Urls
|
crowdstrikefalconiocurls |
multiSelect |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Item Author ID
|
crowdstrikefalconitemauthorid |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Item author
|
crowdstrikefalconitemauthor |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Item date
|
crowdstrikefalconitemdate |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Item id
|
crowdstrikefalconitemid |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Item site
|
crowdstrikefalconitemsite |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Item site ID
|
crowdstrikefalconitemsiteid |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Item type
|
crowdstrikefalconitemtype |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Lead Id
|
crowdstrikefalconleadid |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Lead Type
|
crowdstrikefalconleadtype |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Macros CMD line
|
crowdstrikefalconmacroscmdline |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Macros Display Name
|
crowdstrikefalconmacrosdisplayname |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Macros IOC Description
|
crowdstrikefalconmacrosiocdescription |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Macros IOC Source
|
crowdstrikefalconmacrosiocsource |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Macros IOC Type
|
crowdstrikefalconmacrosioctype |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Mitre Attack
|
crowdstrikefalconmitreattack |
multiSelect |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Mobile Manufacturer
|
crowdstrikefalconmobilemanufacturer |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Mobile Product
|
crowdstrikefalconmobileproduct |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Mobile platform version
|
crowdstrikefalconmobileplatformversion |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Pattern ID
|
crowdstrikefalconpatternid |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Platform Name
|
crowdstrikefalconplatformname |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Product Type Description
|
crowdstrikefalconproducttypedesc |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Request Parameters
|
crowdstrikefalconrequestparameters |
longText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Resource Attributes
|
crowdstrikefalconresourceattributes |
longText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Response Elements
|
crowdstrikefalconresponseelements |
longText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Role ID
|
crowdstrikefalconroleid |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Role creator UID
|
crowdstrikefalconrolecreatoruid |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Role creator name
|
crowdstrikefalconrolecreatorname |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Role priority
|
crowdstrikefalconrolepriority |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Role topic
|
crowdstrikefalconroletopic |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Scan Id
|
crowdstrikefalconscanid |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Scan Name
|
crowdstrikefalconscanname |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Security patch level
|
crowdstrikefalconsecuritypatchlevel |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Service Type
|
crowdstrikefalconservicetype |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon System Manufacturer
|
crowdstrikefalconsystemmanufacturer |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon System Product Name
|
crowdstrikefalconsystemproductname |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon User Agent
|
crowdstrikefalconuseragent |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon User Identity
|
crowdstrikefalconuseridentity |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Vertex ID
|
crowdstrikefalconvertexid |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
CrowdStrike Falcon Vertex Type
|
crowdstrikefalconvertextype |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
Custom Incident Data Structure
|
customincidentdatastructure |
markdown |
Use Case Builder
|
No |
0 |
|
Custom Packs Installed
|
custompacksinstalled |
grid |
XSOAR CI/CD
|
No |
0 |
|
Custom Packs Source
|
custompackssource |
singleSelect |
XSOAR CI/CD
|
No |
0 |
|
Custom Query Results
|
customqueryresults |
markdown |
Common Types
|
No |
0 |
|
CustomNewsGrid
|
customnewsgrid |
grid |
Popular Cybersecurity News
|
No |
0 |
|
Customer Name
|
customername |
shortText |
Use Case Builder
|
No |
0 |
|
CyCognito Affected Asset
|
cycognitoaffectedasset |
shortText |
CyCognito
|
No |
0 |
|
CyCognito Detection Complexity
|
cycognitodetectioncomplexity |
shortText |
CyCognito
|
No |
0 |
|
CyCognito Exploitation Method
|
cycognitoexploitationmethod |
shortText |
CyCognito
|
No |
0 |
|
CyCognito Exploitation Score
|
cycognitoexploitationscore |
number |
CyCognito
|
No |
0 |
|
CyCognito Investigation Status
|
cycognitoinvestigationstatus |
singleSelect |
CyCognito
|
No |
0 |
|
CyCognito Issue ID
|
cycognitoissueid |
shortText |
CyCognito
|
No |
0 |
|
CyCognito Issue Organizations
|
cycognitoissueorganizations |
tagsSelect |
CyCognito
|
No |
0 |
|
CyCognito Issue Status
|
cycognitoissuestatus |
shortText |
CyCognito
|
No |
0 |
|
CyCognito Issue Type
|
cycognitoissuetype |
shortText |
CyCognito
|
No |
0 |
|
CyCognito Issue Type ID
|
cycognitoissuetypeid |
shortText |
CyCognito
|
No |
0 |
|
CyCognito Potential Impact
|
cycognitopotentialimpact |
tagsSelect |
CyCognito
|
No |
0 |
|
CyCognito Potential Threat
|
cycognitopotentialthreat |
shortText |
CyCognito
|
No |
0 |
|
CyCognito References
|
cycognitoreferences |
multiSelect |
CyCognito
|
No |
0 |
|
CyCognito Remediation Step
|
cycognitoremediationstep |
markdown |
CyCognito
|
No |
0 |
|
CyCognito Resolved Time
|
cycognitoresolvedtime |
shortText |
CyCognito
|
No |
0 |
|
CyCognito Severity Score
|
cycognitoseverityscore |
number |
CyCognito
|
No |
0 |
|
CyCognito Summary
|
cycognitosummary |
longText |
CyCognito
|
No |
0 |
|
CyCognito Tags
|
cycognitotags |
multiSelect |
CyCognito
|
No |
0 |
|
CybelAngel Abstract
|
cybelangelabstract |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Abuse Email
|
cybelangelabuseemail |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Analysis
|
cybelangelanalysis |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Asset Urls
|
cybelangelasseturls |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Board
|
cybelangelboard |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel City
|
cybelangelcity |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Country Code
|
cybelangelcountrycode |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Created At
|
cybelangelcreatedat |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Detected At
|
cybelangeldetectedat |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Domain Registered At
|
cybelangeldomainregisteredat |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel IP
|
cybelangelip |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Incident ID
|
cybelangelincidentid |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Incident Type
|
cybelangelincidenttype |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Investigation ID
|
cybelangelinvestigationid |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Keywords
|
cybelangelkeywords |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Language
|
cybelangellanguage |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Liveness
|
cybelangelliveness |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Location
|
cybelangellocation |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel MX Servers
|
cybelangelmxservers |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Machine Name
|
cybelangelmachinename |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Malware Location
|
cybelangelmalwarelocation |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Malware Name
|
cybelangelmalwarename |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Module
|
cybelangelmodule |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel NS Servers
|
cybelangelnsservers |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Origins
|
cybelangelorigins |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Port
|
cybelangelport |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Registrant Email
|
cybelangelregistrantemail |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Registrant Name
|
cybelangelregistrantname |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Report Content
|
cybelangelreportcontent |
longText |
CybelAngel
|
No |
0 |
|
CybelAngel Report Type
|
cybelangelreporttype |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Risks
|
cybelangelrisks |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Samples
|
cybelangelsamples |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Screenshots
|
cybelangelscreenshots |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Sender
|
cybelangelsender |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Sent At
|
cybelangelsentat |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Severity
|
cybelangelseverity |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Solved At
|
cybelangelsolvedat |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Source
|
cybelangelsource |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Stream
|
cybelangelstream |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Suggestions
|
cybelangelsuggestions |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Tags
|
cybelangeltags |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Threat
|
cybelangelthreat |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Title
|
cybelangeltitle |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Updated At
|
cybelangelupdatedat |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel User Session
|
cybelangelusersession |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel UserGroups
|
cybelangelusergroups |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel Volume
|
cybelangelvolume |
shortText |
CybelAngel
|
No |
0 |
|
CybelAngel WHOIS
|
cybelangelwhois |
shortText |
CybelAngel
|
No |
0 |
|
CyberInt Alert Data
|
cyberintalertdata |
markdown |
Cyberint
|
No |
0 |
|
CyberInt Alert ID
|
cyberintalertid |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Alert URL ID
|
cyberintincidentid |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Attachments
|
cyberintattachments |
grid |
Cyberint
|
No |
0 |
|
CyberInt Confidence
|
cyberintconfidence |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Created by
|
cyberintcreatedby |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Created date
|
cyberintcreateddate |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Credentials Exposed CSV
|
cyberintcredentialsexposedcsv |
grid |
Cyberint
|
No |
0 |
|
CyberInt Description
|
cyberintdescription |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Descriptors
|
cyberintdescriptors |
multiSelect |
Cyberint
|
No |
0 |
|
CyberInt Expert Analysis
|
cyberintexpertanalysis |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Impact
|
cyberintimpact |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Impacts
|
cyberintimpacts |
multiSelect |
Cyberint
|
No |
0 |
|
CyberInt Payment Card Exposed CSV
|
cyberintpaymentcardexposedcsv |
grid |
Cyberint
|
No |
0 |
|
CyberInt Recommendation
|
cyberintrecommendation |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Related IOCs
|
cyberintrelatediocs |
grid |
Cyberint
|
No |
0 |
|
CyberInt Related entities
|
cyberintrelatedentities |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Source
|
cyberintsource |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Source category
|
cyberintsourcecategory |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Status
|
cyberintstatus |
singleSelect |
Cyberint
|
No |
0 |
|
CyberInt Tags
|
cyberinttags |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Targeted Brand
|
cyberinttargetedbrand |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Targeted Vector
|
cyberinttargetedvector |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Targeted Vectors
|
cyberinttargetedvectors |
multiSelect |
Cyberint
|
No |
0 |
|
CyberInt Threat Actor
|
cyberintthreatactor |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Ticket ID
|
cyberintticketid |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Title
|
cyberinttitle |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Type
|
cyberinttype |
shortText |
Cyberint
|
No |
0 |
|
CyberInt Vulnerable CName Record
|
cyberinvulnerablecnamerecord |
shortText |
Cyberint
|
No |
0 |
|
Cyberint Alert Close Reason
|
cyberintclosurereason |
singleSelect |
Cyberint
|
No |
0 |
|
Cyberint Alert Close Reason Description
|
cyberintclosurereasondescription |
shortText |
Cyberint
|
No |
0 |
|
Cyberint Category
|
cyberintcategory |
shortText |
Cyberint
|
No |
0 |
|
Cyberint File Type
|
cyberintfiletype |
shortText |
Cyberint
|
No |
0 |
|
Cyberint Related Entity
|
cyberintrelatedentity |
multiSelect |
Cyberint
|
No |
0 |
|
Cyberint Targeted Brands
|
cyberinttargetedbrands |
multiSelect |
Cyberint
|
No |
0 |
|
Cyberpion Action item ID
|
cyberpionactionitemid |
shortText |
Cyberpion
|
No |
0 |
|
Cyberpion Asset
|
cyberpionasset |
shortText |
Cyberpion
|
No |
0 |
|
Cyberpion Category
|
cyberpioncategory |
shortText |
Cyberpion
|
No |
0 |
|
Cyberpion Description
|
cyberpiondescription |
longText |
Cyberpion
|
No |
0 |
|
Cyberpion Domain
|
cyberpiondomain |
shortText |
Cyberpion
|
No |
0 |
|
Cyberpion Impact
|
cyberpionimpact |
longText |
Cyberpion
|
No |
0 |
|
Cyberpion Solution
|
cyberpionsolution |
longText |
Cyberpion
|
No |
0 |
|
Cyberpion Summary
|
cyberpionsummary |
shortText |
Cyberpion
|
No |
0 |
|
Cyberpion Technical Details
|
cyberpiontechnicaldetails |
longText |
Cyberpion
|
No |
0 |
|
Cyberpion Title
|
cyberpiontitle |
shortText |
Cyberpion
|
No |
0 |
|
Cyberpion portal link
|
cyberpionportallink |
shortText |
Cyberpion
|
No |
0 |
|
Cybersixgill Assessment
|
cybersixgillassessment |
longText |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill Attributes
|
cybersixgillattributes |
longText |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill CVSS 2.0
|
cybersixgillcvss20 |
number |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill CVSS 3.1
|
cybersixgillcvss31 |
number |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill DVE Score
|
cybersixgilldvescore |
number |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill Post URL
|
cybersixgillposturl |
shortText |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill Recommendations
|
cybersixgillrecommendations |
longText |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill Status
|
cybersixgillstatus |
singleSelect |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill Suspicious domain
|
cybersixgillsuspiciousdomain |
tagsSelect |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill Threat Level
|
cybersixgillthreatlevel |
singleSelect |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill Threat Type
|
cybersixgillthreattype |
tagsSelect |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill Triggered Assets
|
cybersixgilltriggeredassets |
tagsSelect |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cybersixgill Triggered domain
|
cybersixgilltriggereddomain |
tagsSelect |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Cyble Events Alias
|
cybleeventsalias |
shortText |
Cyble Events (Deprecated)
|
No |
0 |
|
Cyble Events Bucket
|
cybleeventsbucket |
shortText |
Cyble Events (Deprecated)
|
No |
0 |
|
Cyble Events Keyword
|
cybleeventskeyword |
shortText |
Cyble Events (Deprecated)
|
No |
0 |
|
Cyble Events Name
|
cybleeventsname |
shortText |
Cyble Events (Deprecated)
|
No |
0 |
|
CybleEventsV2 Application
|
cybleeventsv2application |
shortText |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 CE Filename
|
cybleeventsv2cefilename |
shortText |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 CE Username
|
cybleeventsv2ceusername |
shortText |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 Card Brand
|
cybleeventsv2cardbrand |
shortText |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 Card CVV
|
cybleeventsv2cardcvv |
shortText |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 Card Expiry
|
cybleeventsv2cardexpiry |
shortText |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 Card Level
|
cybleeventsv2cardlevel |
shortText |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 Card No.
|
cybleeventsv2cardno |
shortText |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 Card Type
|
cybleeventsv2cardtype |
shortText |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 Keyword
|
cybleeventsv2keyword |
shortText |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 Password
|
cybleeventsv2password |
shortText |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 Status
|
cybleeventsv2status |
singleSelect |
CybleEventsV2
|
No |
0 |
|
CybleEventsV2 URL
|
cybleeventsv2url |
shortText |
CybleEventsV2
|
No |
0 |
|
Cymulate Affected Assets
|
cymulateaffectedassets |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Agentless
|
cymulateagentless |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Analysis
|
cymulateanalysis |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Assessment ID
|
cymulateassessmentid |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Assessment Name
|
cymulateassessmentname |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Attack Type
|
cymulateattacktype |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Attack Vector
|
cymulateattackvector |
shortText |
Cymulate
|
No |
0 |
|
Cymulate CIS Compliance Support
|
cymulateciscompliancesupport |
markdown |
Cymulate
|
No |
0 |
|
Cymulate Defense Bypassed
|
cymulatedefensebypassed |
multiSelect |
Cymulate
|
No |
0 |
|
Cymulate Description
|
cymulatedescription |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Environment
|
cymulateenvironment |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Finding Name
|
cymulatefindingname |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Finding Type
|
cymulatefindingtype |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Immediate Threats Attack ID
|
cymulateimmediatethreatsattackid |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Immediate Threats File Type
|
cymulateimmediatethreatsfiletype |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Immediate Threats ID
|
cymulateimmediatethreatsid |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Immediate Threats Mitigations
|
cymulateimmediatethreatsmitigations |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Immediate Threats Module
|
cymulateimmediatethreatsmodule |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Immediate Threats Payload Name
|
cymulateimmediatethreatspayloadname |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Immediate Threats Status
|
cymulateimmediatethreatsstatus |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Immediate Threats Vector
|
cymulateimmediatethreatsvector |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Input
|
cymulateinput |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Last Action
|
cymulatelastaction |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Mitigation Details
|
cymulatemitigationdetails |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Mitigation Type
|
cymulatemitigationtype |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Module
|
cymulatemodule |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Nist Compliance Support
|
cymulatenistcompliancesupport |
markdown |
Cymulate
|
No |
0 |
|
Cymulate Softwares
|
cymulatesoftwares |
markdown |
Cymulate
|
No |
0 |
|
Cymulate Source
|
cymulatesource |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Source Email Address
|
cymulatesourceemailaddress |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Status
|
cymulatestatus |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Template Name
|
cymulatetemplatename |
shortText |
Cymulate
|
No |
0 |
|
Cymulate Test Case
|
cymulatetestcase |
shortText |
Cymulate
|
No |
0 |
|
Cymulate URL
|
cymulateurl |
shortText |
Cymulate
|
No |
0 |
|
Cypho Threat Intelligence Asset
|
cyphoasset |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Attachments
|
cyphoattachments |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Category Name
|
cyphocategoryname |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Checker
|
cyphochecker |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Comments
|
cyphocomments |
longText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Confidence Score
|
cyphoconfidencescore |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Date Detected by Cypho
|
datedetectedbycypho |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Date of Exposure
|
cyphodateofexposure |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Description
|
cyphodescription |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detail
|
cyphodetail |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Attack Type
|
cyphodetectedattacktype |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Base Name
|
cyphodetectedbasename |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected CPEs
|
cyphodetectedcpes |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected CVE ID
|
cyphodetectedcveid |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected CVE Score
|
cyphodetectedcvescore |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected CVE Severity
|
cyphodetectedcveseverity |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Content
|
cyphodetectedcontent |
longText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Content Author Name
|
cyphodetectedcontentauthorname |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Content Page Count
|
cyphodetectedcontentpagecount |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Content Title
|
cyphodetectedcontenttitle |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Developer
|
cyphodetecteddeveloper |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Domains
|
cyphodetecteddomains |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected GitHub Owner Name
|
cyphodetectedgithubownername |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Host
|
cyphodetectedhost |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Http Request Method
|
cyphodetectedhttprequestmethod |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected IP
|
cyphodetectedip |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected New Record
|
cyphodetectednewrecord |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected New Record IP
|
cyphodetectednewrecordip |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Old Record
|
cyphodetectedoldrecord |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Old Record IP
|
cyphodetectedoldrecordip |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Package Name
|
cyphodetectedpackagename |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Parameter
|
cyphodetectedparameter |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Password
|
cyphodetectedpassword |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Payload
|
cyphodetectedpayload |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Phishing Domain Name
|
cyphodetectedphishingdomainname |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Port
|
cyphodetectedport |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Repository Name
|
cyphodetectedrepositoryname |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Request Body
|
cyphodetectedrequestbody |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Request Headers
|
cyphodetectedrequestheaders |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Response Headers
|
cyphodetectedresponseheaders |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Serial Number
|
cyphodetectedserialnumber |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Service Name
|
cyphodetectedservicename |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Service Version
|
cyphodetectedserviceversion |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected Targeted Brand Name
|
cyphodetectedtargetedbrandname |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detected URL
|
cyphodetectedurl |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Detection Source
|
cyphodetectionsource |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Domain Same As Company Keyword Score
|
cyphodomainsameascompanykeywordscore |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Host Path
|
cyphohostpath |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence ID
|
cyphoid |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Login Name
|
cyphologinname |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Messages
|
cyphomessages |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Not Parked Factor Score
|
cyphonotparkedfactorscore |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Product Name
|
cyphoproductname |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Recommendation
|
cyphorecommendation |
longText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Remediation SLA
|
cyphoremediationsla |
timer |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Risk Level
|
cyphorisklevel |
singleSelect |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence SSL/TLS Certificate Expire Date
|
cyphossltlscertificateexpiredate |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Searching keyword
|
cyphosearchingkeyword |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Similarity Rate
|
cyphosimilarityrate |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Status
|
cyphostatus |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Status Reason
|
cyphostatusreason |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Subject Alternative Names
|
cyphosubjectalternativenames |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Subject Common Name
|
cyphosubjectcommonname |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Target Type
|
cyphotargettype |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Tenant Name
|
cyphotenantname |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Threat Intelligence Created at Time
|
cyphocreatedattime |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Threat Intelligence Impact
|
cyphoimpact |
longText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Ticket Id
|
cyphoticketid |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Time to Assignment
|
cyphotimetoassignment |
timer |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Title
|
cyphotitle |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cypho Threat Intelligence Updated at Time
|
cyphoupdatedattime |
shortText |
Cypho Threat Intelligence
|
No |
0 |
|
Cyren Case ID
|
cyrencaseid |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Confidence
|
cyrenconfidence |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Connection ID
|
cyrenconnectionid |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Connection Name
|
cyrenconnectionname |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Email Subject
|
cyrenemailsubject |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren External From
|
cyrenexternalfrom |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren External Reply To
|
cyrenexternalreplyto |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren External Reply To Address
|
cyrenexternalreplytoaddress |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren External Sender
|
cyrenexternalsender |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren From Address
|
cyrenfromaddress |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren From Name
|
cyrenfromname |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Incident ID
|
cyrenincidentid |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Internet Message ID
|
cyreninternetmessageid |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Message Details
|
cyrenmessagedetails |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Message Folder
|
cyrenmessagefolder |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Message ID
|
cyrenmessageid |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Message Read State
|
cyrenmessagereadstate |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Microsoft Tenant ID
|
cyrenmicrosofttenantid |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Org ID
|
cyrenorgid |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Remediation Status
|
cyrenremediationstatus |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Reported By
|
cyrenreportedby |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Sender Address
|
cyrensenderaddress |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Sender Name
|
cyrensendername |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Targeted Address
|
cyrentargetedaddress |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Targeted User
|
cyrentargeteduser |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Threat Indicators
|
cyrenthreatindicators |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren Threat Type
|
cyrenthreattype |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren User Comment
|
cyrenusercomment |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren User Reported As
|
cyrenuserreportedas |
shortText |
Cyren Inbox Security
|
No |
0 |
|
Cyren User Selected Indicators
|
cyrenuserselectedindicators |
shortText |
Cyren Inbox Security
|
No |
0 |
|
DBotPrediction
|
dbotprediction |
shortText |
Phishing
|
No |
0 |
|
DBotPredictionProbability
|
dbotpredictionprobability |
number |
Phishing
|
No |
0 |
|
DBotTextSuggestionHighlighted
|
dbottextsuggestionhighlighted |
markdown |
Phishing
|
No |
0 |
|
DLP Detections
|
dlpdetections |
shortText |
Enterprise DLP by Palo Alto Networks
|
No |
0 |
|
DNS Name
|
dnsname |
multiSelect |
Common Types
|
No |
0 |
|
DNS Query Name
|
dnsqueryname |
multiSelect |
Core Alert Fields
|
No |
0 |
|
DPO E-mail Address
|
dpoemailaddress |
shortText |
Common Scripts
|
No |
0 |
|
DPO Notification
|
dponotification |
singleSelect |
Common Scripts
|
No |
0 |
|
DS Alert Description
|
dsalertdescription |
longText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Alert Email
|
dsalertemail |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Alert Password
|
dsalertpassword |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Alert Risk Factors
|
dsalertriskfactors |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Assets
|
dsassets |
grid |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Auto Closed
|
dsautoclosed |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Comments
|
dscomments |
grid |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Event Action
|
dseventaction |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Event Number
|
dseventnumber |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Impact
|
dsimpact |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Impact Description
|
dsimpactdescription |
longText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Incident Description
|
dsincidentdescription |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Incident ID
|
dsincidentid |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Incident Raised Date
|
dsincidentraiseddate |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Incident Updated Date
|
dsincidentupdateddate |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Mitigation
|
dsmitigation |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Risk Factors
|
dsriskfactors |
longText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Risk Level
|
dsrisklevel |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Severity
|
dsseverity |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Takedown Attachments
|
dstakedownattachments |
grid |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Takedown Comments
|
dstakedowncomments |
grid |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Takedown Targets
|
dstakedowntargets |
grid |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Triage Item ID
|
dstriageitemid |
shortText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DS Triage Title
|
dstriagetitle |
longText |
ReliaQuest Digital Risk Protection
|
No |
0 |
|
DSPM Affects
|
affects |
shortText |
DSPM
|
No |
0 |
|
DSPM Asset Dig Tags
|
assetdigtags |
longText |
DSPM
|
No |
0 |
|
DSPM Cloud
|
cloud |
shortText |
DSPM
|
No |
0 |
|
DSPM First Detectedon
|
firstdetectedon |
shortText |
DSPM
|
No |
0 |
|
DSPM Investigation Link
|
investigationlink |
url |
DSPM
|
No |
0 |
|
DSPM Remediate Instruction
|
remediateinstruction |
shortText |
DSPM
|
No |
0 |
|
DSPM Remediation Description
|
remediationdescription |
longText |
DSPM
|
No |
0 |
|
DSPM Remediation Steps
|
remediatesteps |
longText |
DSPM
|
No |
0 |
|
DSPM Risk Finding Id
|
riskfindingid |
shortText |
DSPM
|
No |
0 |
|
DSPM Service Type
|
servicetype |
shortText |
DSPM
|
No |
0 |
|
Darkmon Account ID
|
darkmonaccountid |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Action Taken
|
darkmonactiontaken |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Affected Components
|
darkmonaffectedcomponents |
multiSelect |
Darkmon
|
No |
0 |
|
Darkmon Brand
|
darkmonbrand |
shortText |
Darkmon
|
No |
0 |
|
Darkmon CVE Severity
|
darkmoncveseverity |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Directory User
|
darkmondirectoryuser |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Distance
|
darkmondistance |
number |
Darkmon
|
No |
0 |
|
Darkmon Employee Email
|
darkmonemployeeemail |
shortText |
Darkmon
|
No |
0 |
|
Darkmon First Compromise
|
darkmonfirstcompromise |
date |
Darkmon
|
No |
0 |
|
Darkmon Last Compromise
|
darkmonlastcompromise |
date |
Darkmon
|
No |
0 |
|
Darkmon Leak ID
|
darkmonleakid |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Leak Type
|
darkmonleaktype |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Observed Domain
|
darkmonobserveddomain |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Password (Redacted)
|
darkmonpasswordredacted |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Protected Email
|
darkmonprotectedemail |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Published At
|
darkmonpublishedat |
date |
Darkmon
|
No |
0 |
|
Darkmon Registered At
|
darkmonregisteredat |
date |
Darkmon
|
No |
0 |
|
Darkmon Screenshot URL
|
darkmonscreenshoturl |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Source
|
darkmonsourcename |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Stealer
|
darkmonstealer |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Threat Actor
|
darkmonthreatactor |
shortText |
Darkmon
|
No |
0 |
|
Darkmon URL
|
darkmonurl |
url |
Darkmon
|
No |
0 |
|
Darkmon Username
|
darkmonusername |
shortText |
Darkmon
|
No |
0 |
|
Darkmon Victim Name
|
darkmonvictimname |
shortText |
Darkmon
|
No |
0 |
|
Darktrace AI Analyst Associated Devices
|
darktraceaianalystassociateddevices |
grid |
Darktrace
|
No |
0 |
|
Darktrace AI Analyst Category
|
darktraceaianalystcategory |
shortText |
Darktrace
|
No |
0 |
|
Darktrace AI Analyst Event Id
|
darktraceaianalysteventid |
shortText |
Darktrace
|
No |
0 |
|
Darktrace AI Analyst Group Id
|
darktraceaianalystgroupid |
shortText |
Darktrace
|
No |
0 |
|
Darktrace AI Analyst Mitre Tactics
|
darktraceaianalystmitretactics |
multiSelect |
Darktrace
|
No |
0 |
|
Darktrace AI Analyst Related Model Breaches
|
darktraceaianalystrelatedmodelbreaches |
grid |
Darktrace
|
No |
0 |
|
Darktrace AI Analyst Score
|
darktraceaianalystscore |
shortText |
Darktrace
|
No |
0 |
|
Darktrace AI Analyst Summary
|
darktraceaianalystsummary |
longText |
Darktrace
|
No |
0 |
|
Darktrace AI Analyst Title
|
darktraceaianalysttitle |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Comment Count
|
darktracecommentcount |
number |
Darktrace
|
No |
0 |
|
Darktrace Device Hostname
|
darktracedevicehostname |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Device ID
|
darktracedeviceid |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Device IP
|
darktracedeviceip |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Device Label
|
darktracedevicelabel |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Device MAC
|
darktracedevicemac |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Device Vendor
|
darktracedevicevendor |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email Action Status
|
darktraceemailactionstatus |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email Actions
|
darktraceemailactions |
multiSelect |
Darktrace
|
No |
0 |
|
Darktrace Email Actions Taken
|
darktraceemailactionstaken |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email Anomaly Score
|
darktraceemailanomalyscore |
number |
Darktrace
|
No |
0 |
|
Darktrace Email Attachments
|
darktraceemailattachments |
number |
Darktrace
|
No |
0 |
|
Darktrace Email Critical Tags
|
darktraceemailcriticaltags |
tagsSelect |
Darktrace
|
No |
0 |
|
Darktrace Email Direction
|
darktraceemaildirection |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email Group Status
|
darktraceemailgroupstatus |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email Informational Tags
|
darktraceemailinformationaltags |
tagsSelect |
Darktrace
|
No |
0 |
|
Darktrace Email Links
|
darktraceemaillinks |
number |
Darktrace
|
No |
0 |
|
Darktrace Email Read Status
|
darktraceemailreadstatus |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email Receipt Status
|
darktraceemailreceiptstatus |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email Recipient
|
darktraceemailrecipient |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email Release Requested
|
darktraceemailreleaserequested |
boolean |
Darktrace
|
No |
0 |
|
Darktrace Email Sender
|
darktraceemailsender |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email Subject
|
darktraceemailsubject |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email Summary
|
darktraceemailsummary |
longText |
Darktrace
|
No |
0 |
|
Darktrace Email Tags
|
darktraceemailtags |
multiSelect |
Darktrace
|
No |
0 |
|
Darktrace Email Time
|
darktraceemailtime |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email UI Link
|
darktraceemailuilink |
url |
Darktrace
|
No |
0 |
|
Darktrace Email UUID
|
darktraceemailuuid |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Email Warning Tags
|
darktraceemailwarningtags |
tagsSelect |
Darktrace
|
No |
0 |
|
Darktrace Model Breach Category
|
darktracemodelbreachcategory |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Model Breach Comment Count
|
darktracemodelbreachcommentcount |
number |
Darktrace
|
No |
0 |
|
Darktrace Model Breach Description
|
darktracemodelbreachdescription |
longText |
Darktrace
|
No |
0 |
|
Darktrace Model Breach ID
|
darktracemodelbreachid |
number |
Darktrace
|
No |
0 |
|
Darktrace Model Breach Name
|
darktracemodelbreachname |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Model Breach Policy Id
|
darktracemodelbreachpolicyid |
number |
Darktrace
|
No |
0 |
|
Darktrace Model Breach Priority
|
darktracemodelbreachpriority |
number |
Darktrace
|
No |
0 |
|
Darktrace Model Breach Score
|
darktracemodelbreachscore |
number |
Darktrace
|
No |
0 |
|
Darktrace Model Breach Tags
|
darktracemodelbreachtags |
tagsSelect |
Darktrace
|
No |
0 |
|
Darktrace Model Breach Unique Identifier
|
darktracemodelbreachuniqueidentifier |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Model ID
|
darktracemodelid |
number |
Darktrace
|
No |
0 |
|
Darktrace Model Name
|
darktracemodelname |
shortText |
Darktrace
|
No |
0 |
|
Darktrace Model Priority
|
darktracemodelpriority |
number |
Darktrace
|
No |
0 |
|
Darktrace Model Tags
|
darktracemodeltags |
tagsSelect |
Darktrace
|
No |
0 |
|
Darktrace Model UUID
|
darktracemodeluuid |
shortText |
Darktrace
|
No |
0 |
|
DarktraceASM Asset Brand
|
darktraceasmassetbrand |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Asset Creation Time
|
darktraceasmassetcreationtime |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Asset ID
|
darktraceasmassetid |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Asset Security Rating
|
darktraceasmassetsecurityrating |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Asset State
|
darktraceasmassetstate |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Asset URL
|
darktraceasmasseturl |
url |
DarktraceASM
|
No |
0 |
|
DarktraceASM Asset Updated Time
|
darktraceasmassetupdatedtime |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Asset is Malicious
|
darktraceasmassetismalicious |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Risk Description
|
darktraceasmriskdescription |
longText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Risk End Time
|
darktraceasmriskendtime |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Risk Evidence
|
darktraceasmriskevidence |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Risk ID
|
darktraceasmriskid |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Risk Proposed Action
|
darktraceasmriskproposedaction |
longText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Risk Security Rating
|
darktraceasmrisksecurityrating |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Risk Start Time
|
darktraceasmriskstarttime |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Risk Title
|
darktraceasmrisktitle |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Risk Type
|
darktraceasmrisktype |
shortText |
DarktraceASM
|
No |
0 |
|
DarktraceASM Risk URL
|
darktraceasmriskurl |
url |
DarktraceASM
|
No |
0 |
|
Data Encryption Status
|
dataencryptionstatus |
multiSelect |
Common Scripts
|
No |
0 |
|
DataBee Analytic
|
databeeanalytic |
markdown |
DataBee
|
No |
0 |
|
DataBee Evidence
|
databeeevidence |
markdown |
DataBee
|
No |
0 |
|
DataBee Findings
|
databeefindings |
markdown |
DataBee
|
No |
0 |
|
DataBee Impact
|
databeeimpact |
shortText |
DataBee
|
No |
0 |
|
DataBee Message
|
databeemessage |
shortText |
DataBee
|
No |
0 |
|
DataBee SIC-CSC
|
databeesiccsc |
markdown |
DataBee
|
No |
0 |
|
Datadog Cloud SIEM
|
datadogcloudsiem |
grid |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Attachment User ID
|
datadogcloudsiemattachmentuserid |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Commander User
|
datadogcloudsiemcommanderuser |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Customer Impact Scope
|
datadogcloudsiemcustomerimpactscope |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Customer Impacted
|
datadogcloudsiemcustomerimpacted |
boolean |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Detect and Create Duration
|
datadogcloudsiemdetectandcreateduration |
number |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Detected
|
datadogcloudsiemdetected |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Detected Method
|
datadogcloudsiemdetectedmethod |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Display Name
|
datadogcloudsiemdisplayname |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Duration
|
datadogcloudsiemduration |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Integrations ID
|
datadogcloudsiemintegrationsid |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Last Modified By
|
datadogcloudsiemlastmodifiedby |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Modified
|
datadogcloudsiemmodified |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Notification Email
|
datadogcloudsiemnotificationemail |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Other Org Id
|
datadogcloudsiemotherorgid |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Other Org User Id
|
datadogcloudsiemotherorguserid |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Public ID
|
datadogcloudsiempublicid |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Relationships User ID
|
datadogcloudsiemrelationshipsuserid |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Repair Time
|
datadogcloudsiemrepairtime |
number |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Resolution Time
|
datadogcloudsiemresolutiontime |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Resolved
|
datadogcloudsiemresolved |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Root Cause
|
datadogcloudsiemrootcause |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM Title
|
datadogcloudsiemtitle |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM User Creation Time
|
datadogcloudsiemusercreationtime |
date |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM User Is Service
|
datadogcloudsiemuserisservice |
boolean |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM User Last Modified
|
datadogcloudsiemuserlastmodified |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM User Status
|
datadogcloudsiemuserstatus |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM User Title
|
datadogcloudsiemusertitle |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM User Verified
|
datadogcloudsiemuserverified |
boolean |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Event ID
|
datadogcloudsiemv2securitysignaleventid |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Host
|
datadogcloudsiemv2securitysignalhost |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal ID
|
datadogcloudsiemv2securitysignalid |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Message
|
datadogcloudsiemv2securitysignalmessage |
markdown |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Rule ID
|
datadogcloudsiemv2securitysignalruleid |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Rule URL
|
datadogcloudsiemv2securitysignalruleurl |
url |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Severity
|
datadogcloudsiemv2securitysignalseverity |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Tags
|
datadogcloudsiemv2securitysignaltags |
tagsSelect |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Timestamp
|
datadogcloudsiemv2securitysignaltimestamp |
date |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Title
|
datadogcloudsiemv2securitysignaltitle |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Triage Archive Comment
|
datadogcloudsiemv2securitysignaltriagearchivecomment |
longText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Triage Archive Reason
|
datadogcloudsiemv2securitysignaltriagearchivereason |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Triage Assignee Name
|
datadogcloudsiemv2securitysignaltriageassigneename |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Triage State
|
datadogcloudsiemv2securitysignaltriagestate |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal Triggering Log ID
|
datadogcloudsiemv2securitysignaltriggeringlogid |
shortText |
Datadog Cloud SIEM
|
No |
0 |
|
Datadog Cloud SIEM V2 Security Signal URL
|
datadogcloudsiemv2securitysignalurl |
url |
Datadog Cloud SIEM
|
No |
0 |
|
Dataminr Pulse Airport
|
dataminrpulseairport |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Alert Timestamp
|
dataminrpulsealerttimestamp |
date |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Alert Topics
|
dataminrpulsealerttopics |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Alert Type
|
dataminrpulsealerttype |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Alert Type Color
|
dataminrpulsealerttypecolor |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Available Related Alerts
|
dataminrpulseavailablerelatedalerts |
number |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Categories
|
dataminrpulsecategories |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Companies
|
dataminrpulsecompanies |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Country
|
dataminrpulsecountry |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Event Corroboration Summary
|
dataminrpulseeventcorroborationsummary |
longText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Event Location Coordinates
|
dataminrpulseeventlocationcoordinates |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Event Location Name
|
dataminrpulseeventlocationname |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Event Location Places
|
dataminrpulseeventlocationplaces |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Event Location Radius
|
dataminrpulseeventlocationradius |
number |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Event Map Large URL
|
dataminrpulseeventmaplargeurl |
url |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Event Map Small URL
|
dataminrpulseeventmapsmallurl |
url |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Event Time
|
dataminrpulseeventtime |
date |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Event Volume
|
dataminrpulseeventvolume |
number |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Event corroboration Timestamp
|
dataminrpulseeventcorroborationtimestamp |
date |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Expand Alert URL
|
dataminrpulseexpandalerturl |
url |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Expand Map URL
|
dataminrpulseexpandmapurl |
url |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Flight Route
|
dataminrpulseflightroute |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Generic Event
|
dataminrpulsegenericevent |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Header Color
|
dataminrpulseheadercolor |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Header Label
|
dataminrpulseheaderlabel |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Impacted Assets
|
dataminrpulseimpactedassets |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Impacted Assets Text
|
dataminrpulseimpactedassetstext |
longText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Intel Agents Discovered Entities
|
dataminrpulseintelagentsdiscoveredentities |
longText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Intel Agents Summary
|
dataminrpulseintelagentssummary |
longText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Intel Agents Timestamp
|
dataminrpulseintelagentstimestamp |
date |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Intel Agents Version
|
dataminrpulseintelagentsversion |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Lists Matched
|
dataminrpulselistsmatched |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Live Brief
|
dataminrpulselivebrief |
longText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Live Brief Timestamp
|
dataminrpulselivebrieftimestamp |
date |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Malware
|
dataminrpulsemalware |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber AS Orgs
|
dataminrpulsemetadatacyberasorgs |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber Address
|
dataminrpulsemetadatacyberaddress |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber Addresses
|
dataminrpulsemetadatacyberaddresses |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber Asns
|
dataminrpulsemetadatacyberasns |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber Hash Values
|
dataminrpulsemetadatacyberhashvalues |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber Hashes
|
dataminrpulsemetadatacyberhashes |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber Malwares
|
dataminrpulsemetadatacybermalwares |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber Orgs
|
dataminrpulsemetadatacyberorgs |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber Threats
|
dataminrpulsemetadatacyberthreats |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber URL
|
dataminrpulsemetadatacyberurl |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber URLs
|
dataminrpulsemetadatacyberurls |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Metadata Cyber Vulnerabilities
|
dataminrpulsemetadatacybervulnerabilities |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Organization
|
dataminrpulseorganization |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Parent Alert ID
|
dataminrpulseparentalertid |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Point Of Interest
|
dataminrpulsepointofinterest |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Post Channels
|
dataminrpulsepostchannels |
multiSelect |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Post English Text
|
dataminrpulsepostenglishtext |
longText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Post Languages
|
dataminrpulsepostlanguages |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Post Link
|
dataminrpulsepostlink |
url |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Post Media
|
dataminrpulsepostmedia |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Post Media Content
|
dataminrpulsepostmediacontent |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Post Media Photo
|
dataminrpulsepostmediaphoto |
html |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Post Text
|
dataminrpulseposttext |
longText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Post Timestamp
|
dataminrpulseposttimestamp |
date |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Publicly Known Person
|
dataminrpulsepubliclyknownperson |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Publisher Category Color
|
dataminrpulsepublishercategorycolor |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Publisher Category ID
|
dataminrpulsepublishercategoryid |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Publisher Category Name
|
dataminrpulsepublishercategoryname |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Publisher Category Short Name
|
dataminrpulsepublishercategoryshortname |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Region
|
dataminrpulseregion |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Related Terms
|
dataminrpulserelatedterms |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Related Terms Query URL
|
dataminrpulserelatedtermsqueryurl |
url |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Sectors
|
dataminrpulsesectors |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Source Channels
|
dataminrpulsesourcechannels |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Source Display Name
|
dataminrpulsesourcedisplayname |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Source Entity Name
|
dataminrpulsesourceentityname |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Source Verified
|
dataminrpulsesourceverified |
boolean |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Sub Caption Bullets Media
|
dataminrpulsesubcaptionbulletsmedia |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Sub Caption Bullets Source
|
dataminrpulsesubcaptionbulletssource |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Sub Caption Bullets content
|
dataminrpulsesubcaptionbulletscontent |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Sub Headline Content
|
dataminrpulsesubheadlinecontent |
multiSelect |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Sub Headline Title
|
dataminrpulsesubheadlinetitle |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Threat Actor
|
dataminrpulsethreatactor |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse User Recent Images
|
dataminrpulseuserrecentimages |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse User Top Hashtags
|
dataminrpulseusertophashtags |
shortText |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Vulnerability
|
dataminrpulsevulnerability |
grid |
Dataminr Pulse
|
No |
0 |
|
Dataminr Pulse Watchlists Matched By Type
|
dataminrpulsewatchlistsmatchedbytype |
grid |
Dataminr Pulse
|
No |
0 |
|
Date/time of the breach
|
datetimeofthebreach |
date |
Common Scripts
|
No |
0 |
|
DeCYFIR Data Details
|
decyfirdatadetails |
grid |
DeCYFIR
|
No |
0 |
|
Deduplication Logic
|
deduplicationlogic |
markdown |
Use Case Builder
|
No |
0 |
|
Defense Evasion Remediation Products
|
defenseevasionremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Demisto REST API Name
|
demistorestapiname |
shortText |
XSOAR Content Update Notifications
|
No |
0 |
|
Department
|
department |
shortText |
Common Types
|
No |
0 |
|
Description
|
description |
shortText |
Common Types
|
No |
0 |
|
Description - Asset
|
descriptionasset |
multiSelect |
Asset
|
No |
0 |
|
Description - Offense
|
descriptionoffense |
shortText |
IBM QRadar
|
No |
0 |
|
Dest
|
dest |
shortText |
Common Types
|
No |
0 |
|
Dest Hostname
|
desthostname |
shortText |
Common Types
|
No |
0 |
|
Dest NT Domain
|
destntdomain |
shortText |
Common Types
|
No |
0 |
|
Dest OS
|
destos |
shortText |
Common Types
|
No |
0 |
|
Destination
|
destination |
shortText |
FireMon Security Manager
|
No |
0 |
|
Destination Geolocation
|
destinationgeolocation |
multiSelect |
Common Types
|
No |
0 |
|
Destination Hostname
|
destinationhostname |
shortText |
Common Types
|
No |
0 |
|
Destination IP
|
destinationip |
shortText |
Common Types
|
No |
0 |
|
Destination IP - Offense
|
destinationipoffense |
multiSelect |
IBM QRadar
|
No |
0 |
|
Destination IPV6
|
destinationipv6 |
multiSelect |
Common Types
|
No |
0 |
|
Destination IPs
|
destinationips |
multiSelect |
Common Types
|
No |
0 |
|
Destination MAC Address
|
destinationmacaddress |
multiSelect |
Common Types
|
No |
0 |
|
Destination Network
|
destinationnetwork |
shortText |
Common Types
|
No |
0 |
|
Destination Network - Offense
|
destinationnetworkoffense |
multiSelect |
IBM QRadar
|
No |
0 |
|
Destination Networks
|
destinationnetworks |
multiSelect |
Common Types
|
No |
0 |
|
Destination Port
|
destinationport |
shortText |
Common Types
|
No |
0 |
|
Destination Ports
|
destinationports |
shortText |
Port Scan
|
No |
0 |
|
Destination Zone Name
|
destinationzonename |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Detected Endpoints
|
detectedendpoints |
shortText |
Common Types
|
No |
0 |
|
Detected External Hosts
|
detectedexternalhosts |
shortText |
Common Types
|
No |
0 |
|
Detected External IPs
|
detectedexternalips |
shortText |
Common Types
|
No |
0 |
|
Detected IPs
|
detectedips |
multiSelect |
Common Types
|
No |
0 |
|
Detected Internal Hosts
|
detectedinternalhosts |
shortText |
Common Types
|
No |
0 |
|
Detected Internal IPs
|
detectedinternalips |
shortText |
Common Types
|
No |
0 |
|
Detected User
|
detecteduser |
multiSelect |
Common Types
|
No |
0 |
|
Detected Users
|
detectedusers |
shortText |
Common Types
|
No |
0 |
|
Detection End Time
|
detectionendtime |
date |
Common Types
|
No |
0 |
|
Detection ID
|
detectionid |
number |
Common Types
|
No |
0 |
|
Detection SLA
|
detectionsla |
timer |
Common Types
|
No |
0 |
|
Detection Ticketed
|
detectionticketed |
boolean |
ExtraHop Reveal(x)
|
No |
0 |
|
Detection URL
|
detectionurl |
url |
Common Types
|
No |
0 |
|
Detection Update Time
|
detectionupdatetime |
date |
Common Types
|
No |
0 |
|
DevSecOps After Commit ID
|
devsecopsaftercommitid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Analysis ID
|
devsecopsanalysisid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task Action
|
devsecopsapptaskaction |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task App ID
|
devsecopsapptaskappid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task App Name
|
devsecopsapptaskappname |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task Completed At
|
devsecopsapptaskcompletedat |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task Conclusion
|
devsecopsapptaskconclusion |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task Head Commit
|
devsecopsapptaskheadcommit |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task Id
|
devsecopsapptaskid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task Name
|
devsecopsapptaskname |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task Output Summary
|
devsecopsapptaskoutputsummary |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task Output Title
|
devsecopsapptaskoutputtitle |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task Owner Login
|
devsecopsapptaskownerlogin |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task PR ID
|
devsecopsapptaskprid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task PR Number
|
devsecopsapptaskprnumber |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task Started At
|
devsecopsapptaskstartedat |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps App Task Status
|
devsecopsapptaskstatus |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Before Commit ID
|
devsecopsbeforecommitid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps CodeQL Alerts
|
devsecopscodeqlalerts |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Commit Author
|
devsecopscommitauthor |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Commit Committer
|
devsecopscommitcommitter |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Commit ID
|
devsecopscommitid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Commit Message
|
devsecopscommitmessage |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Commit Modified Files
|
devsecopscommitmodifiedfiles |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Commit TimeStamp
|
devsecopscommittimestamp |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Commit Tree ID
|
devsecopscommittreeid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Commit URL
|
devsecopscommiturl |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Developer Email
|
devsecopsdeveloperemail |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Developer Name
|
devsecopsdevelopername |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Git Issue Details
|
devsecopsgitissuedetails |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Git Issue Number
|
devsecopsgitissuenumber |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Git Pusher Name
|
devsecopsgitpushername |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Head Commit Author
|
devsecopsheadcommitauthor |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Head Commit Commiter
|
devsecopsheadcommitcommiter |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Head Commit ID
|
devsecopsheadcommitid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Head Commit Message
|
devsecopsheadcommitmessage |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Head Commit TimeStamp
|
devsecopsheadcommittimestamp |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Head Commit Tree ID
|
devsecopsheadcommittreeid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Head Commit URL
|
devsecopsheadcommiturl |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps IaC Vulnerability
|
devsecopsiacvulnerability |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps IaC Vulnerability Description
|
devsecopsiacvulnerabilitydescription |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps IaC Vulnerability Severity
|
devsecopsiacvulnerabilityseverity |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps IaC Vulnerable Files
|
devsecopsiacvulnerablefiles |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Analysis ID
|
devsecopslgtmanalysisid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Analysis Logs URL
|
devsecopslgtmanalysislogsurl |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Analysis Project ID
|
devsecopslgtmanalysisprojectid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Analysis Results URL
|
devsecopslgtmanalysisresultsurl |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Analysis Status
|
devsecopslgtmanalysisstatus |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Project Config
|
devsecopslgtmprojectconfig |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Project Grade
|
devsecopslgtmprojectgrade |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Project ID
|
devsecopslgtmprojectid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Project Language
|
devsecopslgtmprojectlanguage |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Project Name
|
devsecopslgtmprojectname |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Project Status
|
devsecopslgtmprojectstatus |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps LGTM Project URL
|
devsecopslgtmprojecturl |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Language
|
devsecopslanguage |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Organization Name
|
devsecopsorganizationname |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Action
|
devsecopspraction |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Additions
|
devsecopspradditions |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Assignee
|
devsecopsprassignee |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Assignees
|
devsecopsprassignees |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Base Label
|
devsecopsprbaselabel |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Base Size
|
devsecopsprbasesize |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Body
|
devsecopsprbody |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Branch
|
devsecopsprbranch |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Changed Files
|
devsecopsprchangedfiles |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Closed At
|
devsecopsprclosedat |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Comments
|
devsecopsprcomments |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Commits
|
devsecopsprcommits |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Created At
|
devsecopsprcreatedat |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Deletions
|
devsecopsprdeletions |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Head Commit
|
devsecopsprheadcommit |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Head ID
|
devsecopsprheadid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Head Open Issues
|
devsecopsprheadopenissues |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR ID
|
devsecopsprid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Installation ID
|
devsecopsprinstallationid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Mergeable State
|
devsecopsprmergeablestate |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Number
|
devsecopsprnumber |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Pushed At
|
devsecopsprpushedat |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Size
|
devsecopsprsize |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR State
|
devsecopsprstate |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Title
|
devsecopsprtitle |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Updated At
|
devsecopsprupdatedat |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps PR Watchers
|
devsecopsprwatchers |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Project ID
|
devsecopsprojectid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Repository ID
|
devsecopsrepositoryid |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Repository Name
|
devsecopsrepositoryname |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Repository Organization
|
devsecopsrepositoryorganization |
shortText |
DevSecOps
|
No |
0 |
|
DevSecOps Repository URL
|
devsecopsrepositoryurl |
shortText |
DevSecOps
|
No |
0 |
|
Device External IP
|
deviceexternalip |
shortText |
Common Types
|
No |
0 |
|
Device External IPs
|
deviceexternalips |
multiSelect |
Common Types
|
No |
0 |
|
Device G-Suite Account Status
|
devicegsuiteaccountstatus |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Device Group Id
|
devicegroupid |
shortText |
FireMon Security Manager
|
No |
0 |
|
Device Hash
|
devicehash |
shortText |
Common Types
|
No |
0 |
|
Device Id
|
deviceid |
shortText |
Common Types
|
No |
0 |
|
Device Internal IPs
|
deviceinternalips |
multiSelect |
Common Types
|
No |
0 |
|
Device Local IP
|
devicelocalip |
shortText |
Common Types
|
No |
0 |
|
Device MAC Address
|
devicemacaddress |
multiSelect |
Common Types
|
No |
0 |
|
Device Model
|
devicemodel |
shortText |
Common Types
|
No |
0 |
|
Device Name
|
devicename |
shortText |
Common Types
|
No |
0 |
|
Device OS Name
|
deviceosname |
multiSelect |
Common Types
|
No |
0 |
|
Device OS Version
|
deviceosversion |
multiSelect |
Common Types
|
No |
0 |
|
Device OU
|
deviceou |
multiSelect |
Common Types
|
No |
0 |
|
Device Status
|
devicestatus |
shortText |
Common Types
|
No |
0 |
|
Device Time
|
devicetime |
multiSelect |
Common Types
|
No |
0 |
|
Device Username
|
deviceusername |
shortText |
Common Types
|
No |
0 |
|
Digital Guardian ARC UID
|
digitalguardianarcuid |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Activity
|
digitalguardianactivity |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Alarm Name
|
digitalguardianalarmname |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Attachment Filename
|
digitalguardianattachmentfilename |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Classification
|
digitalguardianclassification |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Command line
|
digitalguardiancommandline |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Computer Name
|
digitalguardiancomputername |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Destination Address
|
digitalguardiandestinationaddress |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Destination DNS Domain
|
digitalguardiandestinationdnsdomain |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Email Recipient
|
digitalguardianemailrecipient |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Email Sender
|
digitalguardianemailsender |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Email Subject
|
digitalguardianemailsubject |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Filename
|
digitalguardianfilename |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Parent Process Name
|
digitalguardianparentprocessname |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Policy
|
digitalguardianpolicy |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Process Name
|
digitalguardianprocessname |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Remote Port
|
digitalguardianremoteport |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Sensitivity
|
digitalguardiansensitivity |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Source Address
|
digitalguardiansourceaddress |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Source IP
|
digitalguardiansourceip |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Threat Type
|
digitalguardianthreattype |
shortText |
Digital Guardian
|
No |
0 |
|
Digital Guardian Username
|
digitalguardianusername |
shortText |
Digital Guardian
|
No |
0 |
|
Discovery Remediation Products
|
discoveryremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Display Name
|
displayname |
shortText |
Common Types
|
No |
0 |
|
Domain
|
domain |
shortText |
Core Alert Fields
|
No |
0 |
|
Domain - Offense
|
domainoffense |
shortText |
IBM QRadar
|
No |
0 |
|
Domain Id
|
domainid |
number |
FireMon Security Manager
|
No |
0 |
|
Domain Name
|
domainname |
multiSelect |
Common Types
|
No |
0 |
|
Domain Registrar Abuse Email
|
domainregistrarabuseemail |
shortText |
Common Types
|
No |
0 |
|
Domain Squatting Result
|
domainsquattingresult |
markdown |
Common Types
|
No |
0 |
|
Domain Updated Date
|
domainupdateddate |
shortText |
Common Types
|
No |
0 |
|
DomainToolsIrisDetect
|
domaintoolsirisdetect |
grid |
DomainTools Iris Detect
|
No |
0 |
|
Doppel Brand
|
doppelbrand |
shortText |
Doppel
|
No |
0 |
|
Doppel Entity
|
doppelentity |
url |
Doppel
|
No |
0 |
|
Doppel Entity Content
|
doppelentitycontent |
grid |
Doppel
|
No |
0 |
|
Doppel Entity State
|
doppelentitystate |
singleSelect |
Doppel
|
No |
0 |
|
Doppel Link
|
doppellink |
url |
Doppel
|
No |
0 |
|
Doppel Notes
|
doppelnotes |
shortText |
Doppel
|
No |
0 |
|
Doppel Platform
|
doppelplatform |
shortText |
Doppel
|
No |
0 |
|
Doppel Product
|
doppelproduct |
singleSelect |
Doppel
|
No |
0 |
|
Doppel Queue State
|
doppelqueuestate |
singleSelect |
Doppel
|
No |
0 |
|
Doppel Screenshot URL
|
doppelscreenshoturl |
url |
Doppel
|
No |
0 |
|
Doppel Uploaded By
|
doppeluploadedby |
shortText |
Doppel
|
No |
0 |
|
Dst Ports
|
dstports |
multiSelect |
Common Types
|
No |
0 |
|
Dsts
|
dsts |
multiSelect |
Common Types
|
No |
0 |
|
Duo Account Status
|
duoaccountstatus |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Duo Message
|
duomessage |
shortText |
DuoAuth
|
No |
0 |
|
Duo Message 2
|
duomessage2 |
shortText |
DuoAuth
|
No |
0 |
|
Duo Status
|
duostatus |
shortText |
DuoAuth
|
No |
0 |
|
Duo Status 2
|
duostatus2 |
shortText |
DuoAuth
|
No |
0 |
|
Duration
|
duration |
shortText |
Common Types
|
No |
0 |
|
E-mail Address
|
emailaddress |
shortText |
Common Scripts
|
No |
0 |
|
Edgescan Altered score
|
edgescanalteredscore |
shortText |
Edgescan
|
No |
0 |
|
Edgescan CVES
|
edgescancves |
shortText |
Edgescan
|
No |
0 |
|
Edgescan CVSS Score
|
edgescancvssscore |
shortText |
Edgescan
|
No |
0 |
|
Edgescan CVSS V2 Score
|
edgescancvssv2score |
shortText |
Edgescan
|
No |
0 |
|
Edgescan CVSS V2 Vector
|
edgescancvssv2vector |
shortText |
Edgescan
|
No |
0 |
|
Edgescan CVSS Vector
|
edgescancvssvector |
shortText |
Edgescan
|
No |
0 |
|
Edgescan CVSS Version
|
edgescancvssversion |
shortText |
Edgescan
|
No |
0 |
|
Edgescan Confidence
|
edgescanconfidence |
shortText |
Edgescan
|
No |
0 |
|
Edgescan Layer
|
edgescanlayer |
shortText |
Edgescan
|
No |
0 |
|
Edgescan PCI Compliance Status
|
edgescanpcicompliancestatus |
shortText |
Edgescan
|
No |
0 |
|
Edgescan Risk
|
edgescanrisk |
number |
Edgescan
|
No |
0 |
|
Elasticsearch Event info
|
elasticsearcheventinfo |
shortText |
Elasticsearch
|
No |
0 |
|
Elasticsearch Host
|
elasticsearchhost |
shortText |
Elasticsearch
|
No |
0 |
|
Elasticsearch Machine
|
elasticsearchmachine |
shortText |
Elasticsearch
|
No |
0 |
|
Elasticsearch Source
|
elasticsearchsource |
shortText |
Elasticsearch
|
No |
0 |
|
Elasticsearch Timestamp
|
elasticsearchtimestamp |
shortText |
Elasticsearch
|
No |
0 |
|
Elasticsearch index
|
elasticsearchindex |
shortText |
Elasticsearch
|
No |
0 |
|
Email
|
email |
shortText |
Common Types
|
No |
0 |
|
Email Authenticity Check
|
emailauthenticitycheck |
singleSelect |
Phishing
|
No |
0 |
|
Email Auto-reply
|
emailautoreply |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Email BCC
|
emailbcc |
shortText |
Phishing
|
No |
0 |
|
Email Body
|
emailbody |
longText |
Phishing
|
No |
0 |
|
Email Body Format
|
emailbodyformat |
shortText |
Phishing
|
No |
0 |
|
Email Body HTML
|
emailbodyhtml |
html |
Phishing
|
No |
0 |
|
Email CC
|
emailcc |
shortText |
Phishing
|
No |
0 |
|
Email Classification
|
emailclassification |
singleSelect |
Phishing
|
No |
0 |
|
Email Client Name
|
emailclientname |
shortText |
Phishing
|
No |
0 |
|
Email Delete From Brand
|
emaildeletefrombrand |
singleSelect |
Phishing
|
No |
0 |
|
Email Delete Reason
|
emaildeletereason |
shortText |
Phishing
|
No |
0 |
|
Email Delete Result
|
emaildeleteresult |
shortText |
Phishing
|
No |
0 |
|
Email Delete Type
|
emaildeletetype |
singleSelect |
Phishing
|
No |
0 |
|
Email From
|
emailfrom |
shortText |
Phishing
|
No |
0 |
|
Email Generated Code
|
emailgeneratedcode |
shortText |
Email Communication
|
No |
0 |
|
Email Generated Codes
|
emailgeneratedcodes |
longText |
Email Communication
|
No |
0 |
|
Email HTML
|
emailhtml |
longText |
Phishing
|
No |
0 |
|
Email HTML Image
|
emailhtmlimage |
longText |
Phishing
|
No |
0 |
|
Email Headers
|
emailheaders |
grid |
Phishing
|
No |
0 |
|
Email In Reply To
|
emailinreplyto |
shortText |
Phishing
|
No |
0 |
|
Email Internal Message ID
|
emailinternalmessageid |
shortText |
Phishing
|
No |
0 |
|
Email Keywords
|
emailkeywords |
shortText |
Phishing
|
No |
0 |
|
Email Keywords Found
|
emailkeywordsfound |
tagsSelect |
Phishing
|
No |
0 |
|
Email Labels
|
emaillabels |
shortText |
Phishing
|
No |
0 |
|
Email Latest Message
|
emaillatestmessage |
shortText |
Phishing
|
No |
0 |
|
Email Message ID
|
emailmessageid |
shortText |
Phishing
|
No |
0 |
|
Email New Attachment
|
emailnewattachment |
attachments |
Email Communication
|
No |
0 |
|
Email New Body
|
emailnewbody |
markdown |
Email Communication
|
No |
0 |
|
Email New Recipients
|
emailnewrecipients |
shortText |
Email Communication
|
No |
0 |
|
Email New Subject
|
emailnewsubject |
shortText |
Email Communication
|
No |
0 |
|
Email Queue ID
|
emailqueueid |
shortText |
PhishingAlerts
|
No |
0 |
|
Email Received
|
emailreceived |
shortText |
Phishing
|
No |
0 |
|
Email Recipient
|
emailrecipient |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Email Recipients Count
|
emailrecipientscount |
number |
Phishing
|
No |
0 |
|
Email Reply To
|
emailreplyto |
shortText |
Phishing
|
No |
0 |
|
Email Return Path
|
emailreturnpath |
shortText |
Phishing
|
No |
0 |
|
Email Selected Thread
|
emailselectedthread |
shortText |
Email Communication
|
No |
0 |
|
Email Sender
|
emailsender |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Email Sender IP
|
emailsenderip |
shortText |
Phishing
|
No |
0 |
|
Email Sent Successfully
|
emailsentsuccessfully |
boolean |
Common Types
|
No |
0 |
|
Email Size
|
emailsize |
number |
Phishing
|
No |
0 |
|
Email Source
|
emailsource |
shortText |
Phishing
|
No |
0 |
|
Email Source Domain
|
emailsourcedomain |
shortText |
PhishingAlerts
|
No |
0 |
|
Email Subject
|
emailsubject |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Email Subject
|
emailsubject |
shortText |
Phishing
|
No |
0 |
|
Email To
|
emailto |
shortText |
Phishing
|
No |
0 |
|
Email To Count
|
emailtocount |
shortText |
Phishing
|
No |
0 |
|
Email URL Clicked
|
emailurlclicked |
shortText |
Phishing
|
No |
0 |
|
EmailCampaignCanvas
|
emailcampaigncanvas |
markdown |
Common Types
|
No |
0 |
|
EmailCampaignMutualIndicators
|
emailcampaignmutualindicators |
markdown |
Common Types
|
No |
0 |
|
EmailCampaignSnippets
|
emailcampaignsnippets |
markdown |
Common Types
|
No |
0 |
|
EmailCampaignSummary
|
emailcampaignsummary |
markdown |
Common Types
|
No |
0 |
|
Employee Display Name
|
employeedisplayname |
shortText |
Common Types
|
No |
0 |
|
Employee Email
|
employeeemail |
shortText |
Common Types
|
No |
0 |
|
Employee Manager Email
|
employeemanageremail |
shortText |
Common Types
|
No |
0 |
|
End Time
|
endtime |
shortText |
Common Types
|
No |
0 |
|
End-User Interactiveness
|
enduserinteractiveness |
markdown |
Use Case Builder
|
No |
0 |
|
Endpoint
|
endpoint |
grid |
Common Types
|
No |
0 |
|
Endpoint Isolation Status
|
endpointisolationstatus |
shortText |
Common Types
|
No |
0 |
|
Endpoints Details
|
endpointsdetails |
markdown |
Common Types
|
No |
0 |
|
Enrichment
|
enrichment |
markdown |
Use Case Builder
|
No |
0 |
|
Entity ID
|
entityid |
shortText |
XM Cyber
|
No |
0 |
|
Entity IP Address
|
entityipaddress |
shortText |
XM Cyber
|
No |
0 |
|
Entity is a critical asset
|
entityisacriticalasset |
boolean |
XM Cyber
|
No |
0 |
|
Entity name
|
entityname |
shortText |
XM Cyber
|
No |
0 |
|
Entity report
|
entityreport |
url |
XM Cyber
|
No |
0 |
|
Entity type
|
entitytype |
shortText |
XM Cyber
|
No |
0 |
|
Eradication Task Count
|
eradicationtaskcount |
shortText |
Rapid Breach Response
|
No |
0 |
|
Error Code
|
errorcode |
shortText |
Common Types
|
No |
0 |
|
Error Message
|
errormessage |
longText |
Common Types
|
No |
0 |
|
Escalation
|
escalation |
shortText |
Common Types
|
No |
0 |
|
Event Action
|
eventaction |
singleSelect |
Common Types
|
No |
0 |
|
Event Descriptions
|
eventdescriptions |
multiSelect |
Common Types
|
No |
0 |
|
Event ID
|
eventid |
shortText |
Common Types
|
No |
0 |
|
Event Names
|
eventnames |
multiSelect |
Common Types
|
No |
0 |
|
Event Type
|
eventtype |
shortText |
Common Types
|
No |
0 |
|
Event Type
|
eventtype |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Events
|
events |
multiSelect |
Common Types
|
No |
0 |
|
Exabeam Average Risk Score
|
exabeamaverageriskscore |
number |
Exabeam Advanced Analytics
|
No |
0 |
|
Exabeam Destination Hosts
|
exabeamdestinationhosts |
multiSelect |
Exabeam Security Operations Platform
|
No |
0 |
|
Exabeam Highest Session Login Host
|
exabeamhighestsessionloginhost |
shortText |
Exabeam Advanced Analytics
|
No |
0 |
|
Exabeam Highest Session Number Of Asset
|
exabeamhighestsessionnumberofasset |
number |
Exabeam Advanced Analytics
|
No |
0 |
|
Exabeam Highest Session Number Of Reasons
|
exabeamhighestsessionnumberofreasons |
number |
Exabeam Advanced Analytics
|
No |
0 |
|
Exabeam Id
|
exabeamid |
shortText |
Exabeam Advanced Analytics
|
No |
0 |
|
Exabeam Last Activity Time
|
exabeamlastactivitytime |
date |
Exabeam Advanced Analytics
|
No |
0 |
|
Exabeam Last Activity Type
|
exabeamlastactivitytype |
shortText |
Exabeam Advanced Analytics
|
No |
0 |
|
Exabeam Past Scores
|
exabeampastscores |
multiSelect |
Exabeam Advanced Analytics
|
No |
0 |
|
Exabeam Products
|
exabeamproducts |
multiSelect |
Exabeam Security Operations Platform
|
No |
0 |
|
Exabeam Queue
|
exabeamqueue |
shortText |
Exabeam Advanced Analytics
|
No |
0 |
|
Exabeam Rules
|
exabeamrules |
grid |
Exabeam Security Operations Platform
|
No |
0 |
|
Exabeam Session IDs
|
exabeamsessionids |
multiSelect |
Exabeam Advanced Analytics
|
No |
0 |
|
Exabeam Source Hosts
|
exabeamsourcehosts |
multiSelect |
Exabeam Security Operations Platform
|
No |
0 |
|
Exabeam Vendors
|
exabeamvendors |
multiSelect |
Exabeam Security Operations Platform
|
No |
0 |
|
Exactly what happened, and at what times?
|
exactlywhathappenedandatwhattimes |
shortText |
NIST
|
No |
0 |
|
Excluded
|
excluded |
boolean |
Core Alert Fields
|
No |
0 |
|
Executed Remediation Summary Description
|
executedremediationsummarydescription |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Execution Remediation Products
|
executionremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Exfiltrated Files
|
exfiltratedfiles |
longText |
Code42
|
No |
0 |
|
Exfiltration Remediation Products
|
exfiltrationremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Expanse Activity Status
|
expanseactivitystatus |
singleSelect |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Asset
|
expanseasset |
grid |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Asset Organization Unit
|
expanseassetorganizationunit |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Asset Owner
|
expanseassetowner |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Assignee
|
expanseassignee |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Behavior Rule
|
expansebehaviorrule |
shortText |
Expanse (Deprecated)
|
No |
0 |
|
Expanse Business Unit
|
expansebusinessunit |
shortText |
Expanse (Deprecated)
|
No |
0 |
|
Expanse Business Units
|
expansebusinessunits |
tagsSelect |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Category
|
expansecategory |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Certificate
|
expansecertificate |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Cloud Management Status
|
expansecloudmanagementstatus |
tagsSelect |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Created
|
expansecreated |
date |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Domain
|
expansedomain |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Exposure Type
|
expanseexposuretype |
shortText |
Expanse (Deprecated)
|
No |
0 |
|
Expanse Geolocation
|
expansegeolocation |
grid |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse IP
|
expanseip |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Initial Evidence
|
expanseinitialevidence |
longText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Issue ID
|
expanseissueid |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Issue Type
|
expanseissuetype |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Latest Evidence
|
expanselatestevidence |
longText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse ML Features
|
expansemlfeatures |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Modified
|
expansemodified |
date |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Port
|
expanseport |
number |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Priority
|
expansepriority |
singleSelect |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Progress Status
|
expanseprogressstatus |
singleSelect |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Protocol
|
expanseprotocol |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Provider
|
expanseprovider |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Region
|
expanseregion |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Service
|
expanseservice |
shortText |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Severity
|
expanseseverity |
shortText |
Expanse (Deprecated)
|
No |
0 |
|
Expanse Shadow IT
|
expanseshadowit |
boolean |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
Expanse Tags
|
expansetags |
tagsSelect |
Cortex Xpanse by Palo Alto Networks (Deprecated)
|
No |
0 |
|
ExpanseRawJSONEvent
|
expanserawjsonevent |
shortText |
Expanse (Deprecated)
|
No |
0 |
|
Exposure Level
|
exposurelevel |
shortText |
Common Types
|
No |
0 |
|
External Addresses
|
externaladdresses |
shortText |
Common Types
|
No |
0 |
|
External Category ID
|
externalcategoryid |
multiSelect |
Common Types
|
No |
0 |
|
External Category Name
|
externalcategoryname |
multiSelect |
Common Types
|
No |
0 |
|
External Confidence
|
externalconfidence |
multiSelect |
Common Types
|
No |
0 |
|
External End Time
|
externalendtime |
date |
Common Types
|
No |
0 |
|
External ID
|
externalid |
shortText |
Common Types
|
No |
0 |
|
External Last Updated Time
|
externallastupdatedtime |
date |
Common Types
|
No |
0 |
|
External Link
|
externallink |
url |
Common Types
|
No |
0 |
|
External Severity
|
externalseverity |
multiSelect |
Common Types
|
No |
0 |
|
External Start Time
|
externalstarttime |
date |
Common Types
|
No |
0 |
|
External Status
|
externalstatus |
multiSelect |
Common Types
|
No |
0 |
|
External Sub Category ID
|
externalsubcategoryid |
multiSelect |
Common Types
|
No |
0 |
|
External Sub Category Name
|
externalsubcategoryname |
multiSelect |
Common Types
|
No |
0 |
|
External System ID
|
externalsystemid |
multiSelect |
Common Types
|
No |
0 |
|
ExtraHop Appliance ID
|
extrahopapplianceid |
number |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Hostname
|
extrahophostname |
shortText |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Detection Devices
|
extrahoprevealxdetectiondevices |
grid |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Detection ID
|
extrahoprevealxdetectionid |
number |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Detection Participants
|
extrahoprevealxdetectionparticipants |
grid |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Detection Status
|
extrahoprevealxdetectionstatus |
shortText |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Detection Type
|
extrahoprevealxdetectiontype |
shortText |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) End Time
|
extrahoprevealxendtime |
number |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Mitre Tactics
|
extrahoprevealxmitretactics |
grid |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Mitre Techniques
|
extrahoprevealxmitretechniques |
grid |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Mod Time
|
extrahoprevealxmodtime |
number |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Properties
|
extrahoprevealxproperties |
longText |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Resolution
|
extrahoprevealxresolution |
shortText |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Risk Score
|
extrahoprevealxriskscore |
number |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Start Time
|
extrahoprevealxstarttime |
number |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) Update Time
|
extrahoprevealxupdatetime |
number |
ExtraHop Reveal(x)
|
No |
0 |
|
ExtraHop Reveal(x) User Created
|
extrahoprevealxusercreated |
boolean |
ExtraHop Reveal(x)
|
No |
0 |
|
F5 Silveline Security Policy Name
|
f5silvelinesecuritypolicyname |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Action
|
f5silverlineaction |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Action Reason
|
f5silverlineactionreason |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Alert Type
|
f5silverlinealerttype |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Attack Signature ID
|
f5silverlineattacksignatureid |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Attack Signature Name
|
f5silverlineattacksignaturename |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Attack Type
|
f5silverlineattacktype |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Backend Server IP
|
f5silverlinebackendserverip |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Backend Server Port
|
f5silverlinebackendserverport |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Client IP
|
f5silverlineclientip |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Client Port
|
f5silverlineclientport |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Context Name
|
f5silverlinecontextname |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline DOS Attack Latency
|
f5silverlinedosattacklatency |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline DOS Attack TPS
|
f5silverlinedosattacktps |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline DOS Baseline Latency
|
f5silverlinedosbaselinelatency |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline DOS Baseline TPS
|
f5silverlinedosbaselinetps |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline DOS Detection Threshold
|
f5silverlinedosdetectionthreshold |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Data
|
f5silverlinedata |
longText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Detected Usernames
|
f5silverlinedetectedusernames |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Flow ID
|
f5silverlineflowid |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Geo Location Source IP
|
f5silverlinegeolocationsourceip |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline HTTP Class Name
|
f5silverlinehttpclassname |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline HTTP Method
|
f5silverlinehttpmethod |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline HTTP Strings Detected
|
f5silverlinehttpstringsdetected |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline IP Intelligence Event
|
f5silverlineipintelligenceevent |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline IP Intelligence Policy Name
|
f5silverlineipintelligencepolicyname |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline IRule Log Level
|
f5silverlineiruleloglevel |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline IRule Log Type
|
f5silverlineirulelogtype |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline IRule Name
|
f5silverlineirulename |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline IRule Version
|
f5silverlineiruleversion |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Message Number
|
f5silverlinemessagenumber |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Message Originator Source IP
|
f5silverlinemessageoriginatorsourceip |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Message Type
|
f5silverlinemessagetype |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Mitigate Threshold
|
f5silverlinemitigatethreshold |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Proxy ID
|
f5silverlineproxyid |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Raw Message
|
f5silverlinerawmessage |
longText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Request Side
|
f5silverlinerequestside |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Request Status
|
f5silverlinerequeststatus |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Response Code
|
f5silverlineresponsecode |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Route Domain
|
f5silverlineroutedomain |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline SA Translation Pool
|
f5silverlinesatranslationpool |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline SA Translation Type
|
f5silverlinesatranslationtype |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline SNAT IP
|
f5silverlinesnatip |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline SNAT Port
|
f5silverlinesnatport |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Security Policy update timestamp
|
f5silverlinesecuritypolicyupdatetimestamp |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Security Severity
|
f5silverlinesecurityseverity |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Service ID
|
f5silverlineserviceid |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Staged Signature IDs
|
f5silverlinestagedsignatureids |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Staged Signature Names
|
f5silverlinestagedsignaturenames |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Sub Violations
|
f5silverlinesubviolations |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline TMM Unit
|
f5silverlinetmmunit |
number |
F5 Silverline
|
No |
0 |
|
F5 Silverline Targeted URI
|
f5silverlinetargeteduri |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Threat identifier
|
f5silverlinethreatidentifier |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Translated Dest IP
|
f5silverlinetranslateddestip |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Translated Dest Port
|
f5silverlinetranslateddestport |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Translated IP Protocol
|
f5silverlinetranslatedipprotocol |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Translated Route Domain
|
f5silverlinetranslatedroutedomain |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Translated Source IP
|
f5silverlinetranslatedsourceip |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Translated Source Port
|
f5silverlinetranslatedsourceport |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Translated Vlan
|
f5silverlinetranslatedvlan |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Violation Security Support ID
|
f5silverlineviolationsecuritysupportid |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Violation Timestamp
|
f5silverlineviolationtimestamp |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Violations Details
|
f5silverlineviolationsdetails |
longText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Violations Types
|
f5silverlineviolationstypes |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Virtual Server IP
|
f5silverlinevirtualserverip |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Virtual Server Name
|
f5silverlinevirtualservername |
longText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Virtual Server Port
|
f5silverlinevirtualserverport |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline Web Application Name
|
f5silverlinewebapplicationname |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline X-Forwarded
|
f5silverlinexforwarded |
shortText |
F5 Silverline
|
No |
0 |
|
F5 Silverline support ID
|
f5silverlinesupportid |
shortText |
F5 Silverline
|
No |
0 |
|
FAERE Description
|
faeredescription |
html |
NTT Cyber Threat Sensor
|
No |
0 |
|
FW Name
|
fwname |
multiSelect |
Core Alert Fields
|
No |
0 |
|
FW Rule ID
|
fwruleid |
multiSelect |
Core Alert Fields
|
No |
0 |
|
FW Rule Name
|
fwrulename |
multiSelect |
Core Alert Fields
|
No |
0 |
|
FW Serial Number
|
fwserialnumber |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Failed Logon Events
|
failedlogonevents |
number |
Common Types
|
No |
0 |
|
Failed Logon Events Timeframe
|
failedlogoneventstimeframe |
shortText |
Common Types
|
No |
0 |
|
File Access Date
|
fileaccessdate |
shortText |
Common Types
|
No |
0 |
|
File Blocking Profile Name
|
fileblockingprofilename |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
File Blocking Profile Status
|
fileblockingprofilestatus |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
File Blocking Rules
|
fileblockingrules |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
File Creation Date
|
filecreationdate |
shortText |
Common Types
|
No |
0 |
|
File Hash
|
filehash |
shortText |
Common Types
|
No |
0 |
|
File Hash Blocked
|
filehashblocked |
boolean |
Port Scan
|
No |
0 |
|
File MD5
|
filemd5 |
multiSelect |
Common Types
|
No |
0 |
|
File MD5
|
filemd5 |
multiSelect |
Core Alert Fields
|
No |
0 |
|
File Macro SHA256
|
filemacrosha256 |
multiSelect |
Core Alert Fields
|
No |
0 |
|
File Name
|
filename |
shortText |
Common Types
|
No |
0 |
|
File Name
|
filename |
multiSelect |
Core Alert Fields
|
No |
0 |
|
File Names
|
filenames |
multiSelect |
Common Types
|
No |
0 |
|
File Path
|
filepath |
shortText |
Common Types
|
No |
0 |
|
File Paths
|
filepaths |
multiSelect |
Common Types
|
No |
0 |
|
File Relationships
|
filerelationships |
grid |
Common Types
|
No |
0 |
|
File SHA1
|
filesha1 |
multiSelect |
Common Types
|
No |
0 |
|
File SHA256
|
filesha256 |
multiSelect |
Common Types
|
No |
0 |
|
File SHA256
|
filesha256 |
multiSelect |
Core Alert Fields
|
No |
0 |
|
File Size
|
filesize |
shortText |
Common Types
|
No |
0 |
|
File Upload
|
fileupload |
attachments |
Common Types
|
No |
0 |
|
File path
|
filepath |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Financial information breached
|
financialinformationbreached |
shortText |
Common Scripts
|
No |
0 |
|
FireEye Alert Infection ID
|
fireeyealertinfectionid |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Alert Malicious
|
fireeyealertmalicious |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Alert Vlan
|
fireeyealertvlan |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye C2 Address
|
fireeyec2address |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye C2 Channel
|
fireeyec2channel |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye C2 Host
|
fireeyec2host |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye C2 Port
|
fireeyec2port |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye C2 Protocol
|
fireeyec2protocol |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Domain Name
|
fireeyedomainname |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Download At
|
fireeyefireeyedownloadat |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Email Queue ID
|
fireeyeemailqueueid |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Email Source Domain
|
fireeyeemailsourcedomain |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye HX Agent Containment State
|
fireeyehxagentcontainmentstate |
shortText |
FireEye HX
|
No |
0 |
|
FireEye HX Event Info
|
fireeyehxeventinfo |
shortText |
FireEye HX
|
No |
0 |
|
FireEye Infection ID
|
fireeyeinfectionid |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Infection URL
|
fireeyeinfectionurl |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Malware Info
|
fireeyemalwareinfo |
grid |
FireEye Common Fields
|
No |
0 |
|
FireEye Malware Information
|
fireeyemalwareinformation |
markdown |
FireEye Common Fields
|
No |
0 |
|
FireEye Match Count
|
fireeyematchcount |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Matched Time
|
fireeyematchedtime |
date |
FireEye Common Fields
|
No |
0 |
|
FireEye NX Alert Action
|
fireeyenxalertaction |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert ID
|
fireeyenxalertid |
number |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert Malware Name
|
fireeyenxalertmalwarename |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert SC Version
|
fireeyenxalertscversion |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert Target IP
|
fireeyenxalerttargetip |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert Target MAC Address
|
fireeyenxalerttargetmacaddress |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert Target Port
|
fireeyenxalerttargetport |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert Type
|
fireeyenxalerttype |
singleSelect |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert URL
|
fireeyenxalerturl |
url |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert UUID
|
fireeyenxalertuuid |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert Victim IP
|
fireeyenxalertvictimip |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert Victim MAC Address
|
fireeyenxalertvictimmacaddress |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Alert Victim Port
|
fireeyenxalertvictimport |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Event Attacker IP
|
fireeyenxeventattackerip |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Event CVE ID
|
fireeyenxeventcveid |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Event Destination MAC Address
|
fireeyenxeventdestinationmacaddress |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Event Destination Port
|
fireeyenxeventdestinationport |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Event ID
|
fireeyenxeventid |
number |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Event Rule
|
fireeyenxeventrule |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Event Source MAC Address
|
fireeyenxeventsourcemacaddress |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Event Victim IP
|
fireeyenxeventvictimip |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye NX Event Victim Port
|
fireeyenxeventvictimport |
shortText |
FireEye Network Security (NX)
|
No |
0 |
|
FireEye Signature
|
fireeyesignature |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Signature ID
|
fireeyesignatureid |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Signature Revision
|
fireeyesignaturerevision |
shortText |
FireEye Common Fields
|
No |
0 |
|
FireEye Submitted At
|
fireeyesubmittedat |
shortText |
FireEye Common Fields
|
No |
0 |
|
First Name
|
firstname |
shortText |
Common Types
|
No |
0 |
|
First Seen
|
firstseen |
shortText |
Common Types
|
No |
0 |
|
Flashpoint Affected Domain
|
flashpointaffecteddomain |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Alert ID
|
flashpointalertid |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Alert Text
|
flashpointalerttext |
html |
Flashpoint
|
No |
0 |
|
Flashpoint Basetypes
|
flashpointbasetypes |
multiSelect |
Flashpoint
|
No |
0 |
|
Flashpoint Breach Source
|
flashpointbreachsource |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Breach Source Type
|
flashpointbreachsourcetype |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Compromised Email
|
flashpointcompromisedemail |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Compromised Password
|
flashpointcompromisedpassword |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Container
|
flashpointcontainer |
markdown |
Flashpoint
|
No |
0 |
|
Flashpoint Created Date
|
flashpointcreateddate |
date |
Flashpoint
|
No |
0 |
|
Flashpoint Data Type
|
flashpointdatatype |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Entity ID
|
flashpointentityid |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Entity Name
|
flashpointentityname |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Entity Type
|
flashpointentitytype |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint First Observed Date
|
flashpointfirstobserveddate |
date |
Flashpoint
|
No |
0 |
|
Flashpoint Generated Date
|
flashpointgenerateddate |
date |
Flashpoint
|
No |
0 |
|
Flashpoint Header Indexed At Date
|
flashpointheaderindexedatdate |
date |
Flashpoint
|
No |
0 |
|
Flashpoint ID
|
flashpointid |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Image Safe Search
|
flashpointimagesafesearch |
markdown |
Flashpoint
|
No |
0 |
|
Flashpoint Is Fresh
|
flashpointisfresh |
boolean |
Flashpoint
|
No |
0 |
|
Flashpoint Keyword Text
|
flashpointkeywordtext |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Last Observed Date
|
flashpointlastobserveddate |
date |
Flashpoint
|
No |
0 |
|
Flashpoint Link to Alert
|
flashpointlinktoalert |
url |
Flashpoint
|
No |
0 |
|
Flashpoint Media Storage URI
|
flashpointmediastorageuri |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Media Type
|
flashpointmediatype |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Mime Type
|
flashpointmimetype |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Native ID
|
flashpointnativeid |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Parent Basetypes
|
flashpointparentbasetypes |
multiSelect |
Flashpoint
|
No |
0 |
|
Flashpoint Parent Data Type
|
flashpointparentdatatype |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Password Information
|
flashpointpasswordinformation |
grid |
Flashpoint
|
No |
0 |
|
Flashpoint Password Probable Hash Algorithms
|
flashpointpasswordprobablehashalgorithms |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Phash
|
flashpointphash |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Ports
|
flashpointports |
html |
Flashpoint
|
No |
0 |
|
Flashpoint Read Status
|
flashpointreadstatus |
boolean |
Flashpoint
|
No |
0 |
|
Flashpoint Reason ID
|
flashpointreasonid |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Reason Name
|
flashpointreasonname |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Reason Origin
|
flashpointreasonorigin |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Reason Sources
|
flashpointreasonsources |
multiSelect |
Flashpoint
|
No |
0 |
|
Flashpoint Reason Text
|
flashpointreasontext |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Reason Type
|
flashpointreasontype |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Resource URL
|
flashpointresourceurl |
url |
Flashpoint
|
No |
0 |
|
Flashpoint Services
|
flashpointservices |
html |
Flashpoint
|
No |
0 |
|
Flashpoint Shodan Host
|
flashpointshodanhost |
markdown |
Flashpoint
|
No |
0 |
|
Flashpoint Site Actor Name
|
flashpointsiteactorname |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Site Actor Names
|
flashpointsiteactornames |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Site Name
|
flashpointsitename |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Site Native ID
|
flashpointsitenativeid |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Site Title
|
flashpointsitetitle |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Sort Date
|
flashpointsortdate |
date |
Flashpoint
|
No |
0 |
|
Flashpoint Source
|
flashpointsource |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Source Basetypes
|
flashpointsourcebasetypes |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Source Domain
|
flashpointsourcedomain |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Source File
|
flashpointsourcefile |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Source ID
|
flashpointsourceid |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Source Name
|
flashpointsourcename |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Source Owner
|
flashpointsourceowner |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Source Repo
|
flashpointsourcerepo |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Source Snippet
|
flashpointsourcesnippet |
html |
Flashpoint
|
No |
0 |
|
Flashpoint Source Sort Date
|
flashpointsourcesortdate |
date |
Flashpoint
|
No |
0 |
|
Flashpoint Source URL
|
flashpointsourceurl |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Status
|
flashpointstatus |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Title
|
flashpointtitle |
shortText |
Flashpoint
|
No |
0 |
|
Flashpoint Victim
|
flashpointvictim |
shortText |
Flashpoint
|
No |
0 |
|
Follow Up
|
followup |
boolean |
Common Types
|
No |
0 |
|
Forescout EyeInspect Engine
|
forescouteyeinspectengine |
shortText |
Forescout EyeInspect
|
No |
0 |
|
Forescout EyeInspect L2 Protocol
|
forescouteyeinspectl2protocol |
shortText |
Forescout EyeInspect
|
No |
0 |
|
Forescout EyeInspect L3 Protocol
|
forescouteyeinspectl3protocol |
shortText |
Forescout EyeInspect
|
No |
0 |
|
Forescout EyeInspect L4 Protocol
|
forescoutleyeinspectl4protocol |
shortText |
Forescout EyeInspect
|
No |
0 |
|
Forescout EyeInspect L7 Protocol
|
forescouteyeinspectl7protocol |
shortText |
Forescout EyeInspect
|
No |
0 |
|
Forescout EyeInspect Sensor ID
|
forescouteyeinspectsensorid |
shortText |
Forescout EyeInspect
|
No |
0 |
|
FortiSIEM Attack Tactics
|
fortisiemattacktactics |
grid |
FortiSIEM
|
No |
0 |
|
FortiSIEM Destination User
|
fortisiemdestinationuser |
shortText |
FortiSIEM
|
No |
0 |
|
FortiSIEM Event Type
|
fortisiemeventtype |
shortText |
FortiSIEM
|
No |
0 |
|
FortiSIEM Events
|
fortisiemevents |
grid |
FortiSIEM
|
No |
0 |
|
FortiSIEM Events Count
|
fortisiemeventscount |
number |
FortiSIEM
|
No |
0 |
|
FortiSIEM Incident First Seen
|
fortisiemincidentfirstseen |
date |
FortiSIEM
|
No |
0 |
|
FortiSIEM Incident ID
|
fortisiemincidentid |
number |
FortiSIEM
|
No |
0 |
|
FortiSIEM Incident Last Seen
|
fortisiemincidentlastseen |
date |
FortiSIEM
|
No |
0 |
|
FortiSIEM Incident Report Device Name
|
fortisiemincidentreportdevicename |
shortText |
FortiSIEM
|
No |
0 |
|
FortiSIEM Incident Reporter IP
|
fortisiemincidentreporterip |
shortText |
FortiSIEM
|
No |
0 |
|
FortiSIEM Incident Severity
|
fortisiemincidentseverity |
number |
FortiSIEM
|
No |
0 |
|
FortiSIEM Resolution Status
|
fortisiemresolutionstatus |
shortText |
FortiSIEM
|
No |
0 |
|
FortiSIEM Status
|
fortisiemstatus |
shortText |
FortiSIEM
|
No |
0 |
|
FraudWatch Abuse Type
|
fraudwatchabusetype |
shortText |
FraudWatch PhishPortal
|
No |
0 |
|
FraudWatch Abuse URL
|
fraudwatchabuseurl |
url |
FraudWatch PhishPortal
|
No |
0 |
|
FraudWatch Additional URLs
|
fraudwatchadditionalurls |
longText |
FraudWatch PhishPortal
|
No |
0 |
|
FraudWatch Brand
|
fraudwatchbrand |
shortText |
FraudWatch PhishPortal
|
No |
0 |
|
FraudWatch Reference ID
|
fraudwatchreferenceid |
shortText |
FraudWatch PhishPortal
|
No |
0 |
|
Freestyle Hunt
|
freestylehunt |
shortText |
Proactive Threat Hunting
|
No |
0 |
|
FreshworksFreshservice Agent ID
|
freshworksfreshserviceagentid |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Analysis Fields
|
freshworksfreshserviceanalysisfields |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Approval Status
|
freshworksfreshserviceapprovalstatus |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Assets
|
freshworksfreshserviceassets |
grid |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Attachments
|
freshworksfreshserviceattachments |
grid |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Category
|
freshworksfreshservicecategory |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Change Status
|
freshworksfreshservicechangestatus |
singleSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Change Type
|
freshworksfreshservicechangetype |
singleSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Custom Fields
|
freshworksfreshservicecustomfields |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Deleted
|
freshworksfreshservicedeleted |
boolean |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Department ID
|
freshworksfreshservicedepartmentid |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Due By
|
freshworksfreshservicedueby |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Group ID
|
freshworksfreshservicegroupid |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Impact
|
freshworksfreshserviceimpact |
singleSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Impacted Services
|
freshworksfreshserviceimpactedservices |
multiSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Incident Type
|
freshworksfreshserviceincidenttype |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Item Category
|
freshworksfreshserviceitemcategory |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Known Error
|
freshworksfreshserviceknownerror |
boolean |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Planned End Date
|
freshworksfreshserviceplannedenddate |
date |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Planned Start Date
|
freshworksfreshserviceplannedstartdate |
date |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Priority
|
freshworksfreshservicepriority |
singleSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Problem Status
|
freshworksfreshserviceproblemstatus |
singleSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Release ID
|
freshworksfreshservicereleaseid |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Release Status
|
freshworksfreshservicereleasestatus |
singleSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Release Type
|
freshworksfreshservicereleasetype |
singleSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Requester ID
|
freshworksfreshservicerequesterid |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Responder ID
|
freshworksfreshserviceresponderid |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Risk
|
freshworksfreshservicerisk |
singleSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Source
|
freshworksfreshservicesource |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Spam
|
freshworksfreshservicespam |
boolean |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Sub Category
|
freshworksfreshservicesubcategory |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Tags
|
freshworksfreshservicetags |
multiSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Task
|
freshworksfreshservicetask |
grid |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Ticket Status
|
freshworksfreshserviceticketstatus |
singleSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Ticket Type
|
freshworksfreshservicetickettype |
shortText |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Urgency
|
freshworksfreshserviceurgency |
singleSelect |
Freshworks Freshservice
|
No |
0 |
|
FreshworksFreshservice Workspace ID
|
freshworksfreshserviceworkspaceid |
shortText |
Freshworks Freshservice
|
No |
0 |
|
Full Name
|
fullname |
shortText |
Common Types
|
No |
0 |
|
GDPR Notify Authorities
|
gdprnotifyauthorities |
timer |
Common Scripts
|
No |
0 |
|
GIB Address
|
gibaddress |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Admiralty Code
|
gibadmiraltycode |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Affected Software Table
|
gibaffectedsoftwaretable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Base Name
|
gibbasename |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Bulletin Family
|
gibbulletinfamily |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CNC
|
gibcnc |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CNC ASN
|
gibcncasn |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CNC City
|
gibcnccity |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CNC Country Code
|
gibcnccountrycode |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CNC Country Name
|
gibcnccountryname |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CNC Domain
|
gibcncdomain |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CNC IP
|
gibcncip |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CNC Port
|
gibcncport |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CNC Provider
|
gibcncprovider |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CNC Region
|
gibcncregion |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CNC URL
|
gibcncurl |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CPE Table
|
gibcpetable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CVSS Score
|
gibcvssscore |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CVSS Vector
|
gibcvssvector |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB CVV
|
gibcvv |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Card BIN
|
gibcardbin |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Card Category
|
gibcardcategory |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Card Dump
|
gibcarddump |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Card Issuer
|
gibcardissuer |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Card Issuer Country Code
|
gibcardissuercountrycode |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Card Issuer Country Name
|
gibcardissuercountryname |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Card Number
|
gibcardnumber |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Card PIN
|
gibcardpin |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Card Type
|
gibcardtype |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Card Valid Thru
|
gibcardvalidthru |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Card Valid Thru Date
|
gibcardvalidthrudate |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Client ASN
|
gibclientasn |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Client City
|
gibclientcity |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Client Country Code
|
gibclientcountrycode |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Client Country Name
|
gibclientcountryname |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Client IP
|
gibclientip |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Client Provider
|
gibclientprovider |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Client Region
|
gibclientregion |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Compromised Account
|
gibcompromisedaccount |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Compromised Events Information Table
|
gibcompromisedeventsinformationtable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Compromised Events Table
|
gibcompromisedeventstable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Compromised Login
|
gibcompromisedlogin |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Country Code
|
gibcountrycode |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Country Name
|
gibcountryname |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Credibility
|
gibcredibility |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Cybercriminal Expertises
|
gibcybercriminalexpertises |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Cybercriminal Forums Table
|
gibcybercriminalforumstable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Cybercriminal Malware
|
gibcybercriminalmalware |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Cybercriminal Regions
|
gibcybercriminalregions |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Cybercriminal Sectors
|
gibcybercriminalsectors |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Cybercriminal Threat Actor Aliases
|
gibcybercriminalthreatactoraliases |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Cybercriminal Threat Actor Description
|
gibcybercriminalthreatactordescription |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Cybercriminal Threat Actor Report Authors
|
gibcybercriminalthreatactorreportauthors |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Cybercriminal Threat Actor Reports Table
|
gibcybercriminalthreatactorreportstable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Cybercriminal Threat Description
|
gibcybercriminalthreatdescription |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Cybercriminal Threat Title
|
gibcybercriminalthreattitle |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Date Begin
|
gibddosdatebegin |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Date End
|
gibddosdateend |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Date Registration
|
gibddosdateregistration |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Duration
|
gibddosduration |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Protocol
|
gibddosprotocol |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Request Body
|
gibddosrequestbody |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Request Body Hash
|
gibddosrequestbodyhash |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Request Data Link
|
gibddosrequestdatalink |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Request Headers Body
|
gibddosrequestheadersbody |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Request Headers Hash
|
gibddosrequestheadershash |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Source
|
gibddossource |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Target ASN
|
gibddostargetasn |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Target Category
|
gibddostargetcategory |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Target City
|
gibddostargetcity |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Target Country Code
|
gibddostargetcountrycode |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Target Country Name
|
gibddostargetcountryname |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Target Domain
|
gibddostargetdomain |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Target IP
|
gibddostargetip |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Target Port
|
gibddostargetport |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Target Provider
|
gibddostargetprovider |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Target Region
|
gibddostargetregion |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Target URL
|
gibddostargeturl |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DDOS Type
|
gibddostype |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB DRP Approve State
|
gibdrpapprovestate |
shortText |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Approved
|
gibdrpapproved |
date |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Brand
|
gibdrpbrand |
shortText |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Company
|
gibdrpcompany |
shortText |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Created
|
gibdrpcreated |
date |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Current Status Date
|
gibdrpcurrentstatusdate |
date |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Description
|
gibdrpdescription |
longText |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Detected
|
gibdrpdetected |
date |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP First Active
|
gibdrpfirstactive |
date |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP First Detected
|
gibdrpfirstdetected |
date |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP First Solved
|
gibdrpfirstsolved |
date |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Found
|
gibdrpfound |
date |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP HTML Images
|
gibdrphtmlimages |
html |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP ID
|
gibdrpid |
shortText |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Images
|
gibdrpimages |
attachments |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Link
|
gibdrplink |
url |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Scores Table
|
gibdrpscorestable |
grid |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Source
|
gibdrpsource |
shortText |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Status
|
gibdrpstatus |
shortText |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Tags
|
gibdrptags |
multiSelect |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Title
|
gibdrptitle |
shortText |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Type
|
gibdrptype |
shortText |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Typosquatting Status
|
gibdrptyposquattingstatus |
boolean |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB DRP Violation URI
|
gibdrpviolationuri |
shortText |
Group-IB Digital Risk Protection
|
No |
0 |
|
GIB Data Hash
|
gibdatahash |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date Add
|
gibdateadd |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date Compromised
|
gibdatecompromised |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date Created
|
gibdatecreated |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date Created At
|
gibdatecreatedat |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date Expired
|
gibdateexpired |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date First Compromised
|
gibdatefirstcompromised |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date First Seen
|
gibdatefirstseen |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date Incident
|
gibdateincident |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date Last Compromised
|
gibdatelastcompromised |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date Last Seen
|
gibdatelastseen |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date Modified
|
gibdatemodified |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date Published
|
gibdatepublished |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date Updated At
|
gibdateupdatedat |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Date of Detection
|
gibdateofdetection |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Deface Contacts
|
gibdefacecontacts |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Deface Date
|
gibdefacedate |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Deface Site URL
|
gibdefacesiteurl |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Deface Source
|
gibdefacesource |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Downloaded From
|
gibdownloadedfrom |
markdown |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Downloaded From Table
|
gibdownloadedfromtable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Drop Email
|
gibdropemail |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Drop Email Domain
|
gibdropemaildomain |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Email
|
gibemail |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Email Domains
|
gibemaildomains |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Emails
|
gibemails |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Extended CVSS Base
|
gibextendedcvssbase |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Extended CVSS Exploitability
|
gibextendedcvssexploitability |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Extended CVSS Impact
|
gibextendedcvssimpact |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Extended CVSS Overall
|
gibextendedcvssoverall |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Extended CVSS Temporal
|
gibextendedcvsstemporal |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Extended Description
|
gibextendeddescription |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Favicon
|
gibfavicon |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB GIT Source
|
gibgitsource |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB HTML
|
gibhtml |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Has Exploit
|
gibhasexploit |
boolean |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Href
|
gibhref |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB ID
|
gibid |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Inject Dump
|
gibinjectdump |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Inject MD5
|
gibinjectmd5 |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Is Dump
|
gibisdump |
boolean |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Is Expired
|
gibisexpired |
boolean |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Is Masked
|
gibismasked |
boolean |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Is Tailored
|
gibistailored |
tagsSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Leak Name
|
gibleakname |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Leak Published
|
gibleakpublished |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Leaked Data
|
gibleakeddata |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Leaked File Name
|
gibleakedfilename |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Link List
|
giblinklist |
markdown |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Link List Table
|
giblinklisttable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware Aliases
|
gibmalwarealiases |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware CNC Domain
|
gibmalwarecncdomain |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware Categories
|
gibmalwarecategories |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware Description
|
gibmalwaredescription |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware File hash
|
gibmalwarefilehash |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware ID
|
gibmalwareid |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware Langs
|
gibmalwarelangs |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware Name
|
gibmalwarename |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware Platforms
|
gibmalwareplatforms |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware Regions
|
gibmalwareregions |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware STIX GUID
|
gibmalwarestixguid |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware Short Description
|
gibmalwareshortdescription |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware Source Countries
|
gibmalwaresourcecountries |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Malware Table
|
gibmalwaretable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Matches
|
gibmatches |
markdown |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Matches Table
|
gibmatchestable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Merged Cvss
|
gibmergedcvss |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Mirror Link
|
gibmirrorlink |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Name Servers
|
gibnameservers |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminal Forums Table
|
gibnationstatecybercriminalforumstable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Expertises
|
gibnationstatecybercriminalsexpertises |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Malware
|
gibnationstatecybercriminalsmalware |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Regions
|
gibnationstatecybercriminalsregions |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Sectors
|
gibnationstatecybercriminalssectors |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Actor Aliases
|
gibnationstatecybercriminalsthreatactoraliases |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Actor CVE
|
gibnationstatecybercriminalsthreatactorcve |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Actor Country
|
gibnationstatecybercriminalsthreatactorcountry |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Actor Description
|
gibnationstatecybercriminalsthreatactordescription |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Actor Goals
|
gibnationstatecybercriminalsthreatactorgoals |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Actor Labels
|
gibnationstatecybercriminalsthreatactorlabels |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Actor Reports Table
|
gibnationstatecybercriminalsthreatactorreportstable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Actor Roles
|
gibnationstatecybercriminalsthreatactorroles |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Countries
|
gibnationstatecybercriminalsthreatcountries |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Description
|
gibnationstatecybercriminalsthreatdescription |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Expertises
|
gibnationstatecybercriminalsthreatexpertises |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Langs
|
gibnationstatecybercriminalsthreatlangs |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Regions
|
gibnationstatecybercriminalsthreatregions |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Report Number
|
gibnationstatecybercriminalsthreatreportnumber |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Sectors
|
gibnationstatecybercriminalsthreatsectors |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Nation-State Cybercriminals Threat Title
|
gibnationstatecybercriminalsthreattitle |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB OSI Git Repository Files Table
|
gibosigitrepositoryfilestable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Organization BIC
|
giborganizationbic |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Organization BSB
|
giborganizationbsb |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Organization CLABE
|
giborganizationclabe |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Organization IBAN
|
giborganizationiban |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Organization Name
|
giborganizationname |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Organization SWIFT
|
giborganizationswift |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Owner Birthday
|
gibownerbirthday |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Owner City
|
gibownercity |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Owner Country Code
|
gibownercountrycode |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Owner Passport
|
gibownerpassport |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Owner State
|
gibownerstate |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Owner Tax Number
|
gibownertaxnumber |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Owner ZIP
|
gibownerzip |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Parsed Login Domain
|
gibparsedlogindomain |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Parsed Login IP
|
gibparsedloginip |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Password
|
gibpassword |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Passwords
|
gibpasswords |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Payment System
|
gibpaymentsystem |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Person
|
gibperson |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Brand
|
gibphishingbrand |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Date Added
|
gibphishingdateadded |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Date Blocked
|
gibphishingdateblocked |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Date Detected
|
gibphishingdatedetected |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Date Updated
|
gibphishingdateupdated |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Domain
|
gibphishingdomain |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Domain Expiration Date
|
gibphishingdomainexpirationdate |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Domain Puny
|
gibphishingdomainpuny |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing IP Table
|
gibphishingiptable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Kit Email
|
gibphishingkitemail |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Kit Emails
|
gibphishingkitemails |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Kit Hash
|
gibphishingkithash |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Kit Path
|
gibphishingkitpath |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Kit Source
|
gibphishingkitsource |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Kit Table
|
gibphishingkittable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Objectives
|
gibphishingobjectives |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Registrar
|
gibphishingregistrar |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Sources
|
gibphishingsources |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Status
|
gibphishingstatus |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing Type
|
gibphishingtype |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Phishing URLs
|
gibphishingurls |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Portal Link
|
gibportallink |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Price Currency
|
gibpricecurrency |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Price Value
|
gibpricevalue |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Provider Domain
|
gibproviderdomain |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Proxy Port
|
gibproxyport |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Proxy Source
|
gibproxysource |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Proxy Sources
|
gibproxysources |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Proxy Type
|
gibproxytype |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Related Indicators Data
|
gibrelatedindicatorsdata |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Reliability
|
gibreliability |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Report Number
|
gibreportnumber |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Reporter
|
gibreporter |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Repository
|
gibrepository |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Revisions
|
gibrevisions |
markdown |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB SPD Events Table
|
gibspdeventstable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB SPD Illegal Score
|
gibspdillegalscore |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB SPD Malware Table
|
gibspdmalwaretable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB SPD Owner Name
|
gibspdownername |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB SPD Service Type
|
gibspdservicetype |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB SPD Sources Table
|
gibspdsourcestable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB SPD Threat Actor Table
|
gibspdthreatactortable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB SPD Type
|
gibspdtype |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB SPD Value
|
gibspdvalue |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Scanner Categories
|
gibscannercategories |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Scanner Sources
|
gibscannersources |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Screenshot
|
gibscreenshot |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Service Domain
|
gibservicedomain |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Service IP
|
gibserviceip |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Service URL
|
gibserviceurl |
url |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Severity
|
gibseverity |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Socks Proxy Source
|
gibsocksproxysource |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Source
|
gibsource |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Source Link
|
gibsourcelink |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB TLP
|
gibtlp |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB TTL
|
gibttl |
number |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Target ASN
|
gibtargetasn |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Target Brand
|
gibtargetbrand |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Target Category
|
gibtargetcategory |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Target City
|
gibtargetcity |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Target Domain
|
gibtargetdomain |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Target Domain Provider
|
gibtargetdomainprovider |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Target IP
|
gibtargetip |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Target Provider
|
gibtargetprovider |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Target Region
|
gibtargetregion |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Threat Actor Country
|
gibthreatactorcountry |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Threat Actor ID
|
gibthreatactorid |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Threat Actor Name
|
gibthreatactorname |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Threat Actor STIX GUID
|
gibthreatactorstixguid |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Threat Actor is APT
|
gibthreatactorisapt |
boolean |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Threat Actors Table
|
gibthreatactorstable |
grid |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Threat Level
|
gibthreatlevel |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Title
|
gibtitle |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Track
|
gibtrack |
longText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Update Time
|
gibupdatetime |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Upload Time
|
gibuploadtime |
date |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB VPN Names
|
gibvpnnames |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB VPN Sources
|
gibvpnsources |
multiSelect |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Victim IP
|
gibvictimip |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GIB Vulnerability Type
|
gibvulnerabilitytype |
shortText |
Group-IB Threat Intelligence
|
No |
0 |
|
GLPI Assigned To
|
glpiassignedto |
shortText |
GLPI
|
No |
0 |
|
GLPI Assigned To Group
|
glpiassignedtogroup |
shortText |
GLPI
|
No |
0 |
|
GLPI Category
|
glpicategory |
shortText |
GLPI
|
No |
0 |
|
GLPI Closing Date
|
glpiclosingdate |
shortText |
GLPI
|
No |
0 |
|
GLPI Description
|
glpidescription |
html |
GLPI
|
No |
0 |
|
GLPI Impact
|
glpiimpact |
singleSelect |
GLPI
|
No |
0 |
|
GLPI Internal Time To Own
|
glpiinternaltimetoown |
shortText |
GLPI
|
No |
0 |
|
GLPI Internal Time To Resolve
|
glpiinternaltimetoresolve |
shortText |
GLPI
|
No |
0 |
|
GLPI Opening Date
|
glpiopeningdate |
shortText |
GLPI
|
No |
0 |
|
GLPI Priority
|
glpipriority |
singleSelect |
GLPI
|
No |
0 |
|
GLPI Request Source
|
glpirequestsource |
shortText |
GLPI
|
No |
0 |
|
GLPI Requester
|
glpirequester |
shortText |
GLPI
|
No |
0 |
|
GLPI Requester Group
|
glpirequestergroup |
shortText |
GLPI
|
No |
0 |
|
GLPI Solved Date
|
glpisolveddate |
shortText |
GLPI
|
No |
0 |
|
GLPI Status
|
glpistatus |
singleSelect |
GLPI
|
No |
0 |
|
GLPI Ticket ID
|
glpiticketid |
shortText |
GLPI
|
No |
0 |
|
GLPI Time To Own
|
glpitimetoown |
shortText |
GLPI
|
No |
0 |
|
GLPI Time To Resolve
|
glpitimetoresolve |
shortText |
GLPI
|
No |
0 |
|
GLPI Type
|
glpitype |
singleSelect |
GLPI
|
No |
0 |
|
GLPI Urgency
|
glpiurgency |
singleSelect |
GLPI
|
No |
0 |
|
GLPI Watcher
|
glpiwatcher |
shortText |
GLPI
|
No |
0 |
|
GLPI Watcher Group
|
glpiwatchergroup |
shortText |
GLPI
|
No |
0 |
|
GRA Case
|
gracase |
shortText |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Anomaly Details
|
gracaseanomalydetails |
grid |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Entity
|
gracaseentity |
shortText |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Entity Id
|
gracaseentityid |
shortText |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Entity Type Id
|
gracaseentitytypeid |
shortText |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Open Date
|
gracaseopendate |
shortText |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Owner Id
|
gracaseownerid |
shortText |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Owner Name
|
gracaseownername |
shortText |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Owner Type
|
gracaseownertype |
shortText |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Risk Date
|
gracaseriskdate |
shortText |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Risk Score
|
gracaseriskscore |
shortText |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Status
|
gracasestatus |
shortText |
Gurucul Risk Analytics
|
No |
0 |
|
GRA Case Weblink
|
gracaseweblink |
url |
Gurucul Risk Analytics
|
No |
0 |
|
GSuiteSAC Alert ID
|
gsuitesacalertid |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Alert Severity
|
gsuitesacalertseverity |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Alert Source
|
gsuitesacalertsource |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Alert Status
|
gsuitesacalertstatus |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Alert Type
|
gsuitesacalerttype |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Create Time
|
gsuitesaccreatetime |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Customer ID
|
gsuitesaccustomerid |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Deleted
|
gsuitesacdeleted |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC End Time
|
gsuitesacendtime |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Etag
|
gsuitesacetag |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Feedback Create Time
|
gsuitesacfeedbackcreatetime |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Feedback Email
|
gsuitesacfeedbackemail |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Feedback ID
|
gsuitesacfeedbackid |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Feedback Type
|
gsuitesacfeedbacktype |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Security Investigation Tool Link
|
gsuitesacsecurityinvestigationtoollink |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Start Time
|
gsuitesacstarttime |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GSuiteSAC Update Time
|
gsuitesacupdatetime |
shortText |
G Suite Security Alert Center
|
No |
0 |
|
GTI ASM Issue Alias Group
|
gtiasmissuealiasgroup |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Category
|
gtiasmissuecategory |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Collection
|
gtiasmissuecollection |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Collection Type
|
gtiasmissuecollectiontype |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Collection UUID
|
gtiasmissuecollectionuuid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Confidence
|
gtiasmissueconfidence |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Dynamic ID
|
gtiasmissuedynamicid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Entity Name
|
gtiasmissueentityname |
url |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Entity Type
|
gtiasmissueentitytype |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Entity UID
|
gtiasmissueentityuid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue First Seen
|
gtiasmissuefirstseen |
date |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Identifiers
|
gtiasmissueidentifiers |
grid |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Last Seen
|
gtiasmissuelastseen |
date |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Name
|
gtiasmissuename |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Organization UUID
|
gtiasmissueorganizationuuid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Scoped
|
gtiasmissuescoped |
boolean |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Status
|
gtiasmissuestatus |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Status New
|
gtiasmissuestatusnew |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Status New Detailed
|
gtiasmissuestatusnewdetailed |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Ticket List
|
gtiasmissueticketlist |
multiSelect |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue UID
|
gtiasmissueuid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue UUID
|
gtiasmissueuuid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI ASM Issue Upstream
|
gtiasmissueupstream |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert AI Doc Summary
|
gtidtmalertaidocsummary |
longText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Aggregation ID
|
gtidtmalertaggregationid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Analysis
|
gtidtmalertanalysis |
longText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Attachments
|
gtidtmalertattachments |
grid |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Confidence Score
|
gtidtmalertconfidencescore |
number |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Created At
|
gtidtmalertcreatedat |
date |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Body
|
gtidtmalertdocbody |
html |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Description
|
gtidtmalertdocdescription |
longText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Details
|
gtidtmalertdocdetails |
markdown |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Domain
|
gtidtmalertdocdomain |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc ID
|
gtidtmalertdocid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Ingested Time
|
gtidtmalertdocingestedtime |
date |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Item Type
|
gtidtmalertdocitemtype |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Language
|
gtidtmalertdoclanguage |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Message ID
|
gtidtmalertdocmessageid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Paste ID
|
gtidtmalertdocpasteid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Post Date
|
gtidtmalertdocpostdate |
date |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Raw Text
|
gtidtmalertdocrawtext |
html |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Similar Domains
|
gtidtmalertdocsimilardomains |
multiSelect |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Source
|
gtidtmalertdocsource |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Subject
|
gtidtmalertdocsubject |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Timestamp
|
gtidtmalertdoctimestamp |
date |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Title
|
gtidtmalertdoctitle |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Topic ID
|
gtidtmalertdoctopicid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Doc Type
|
gtidtmalertdoctype |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Email Sent At
|
gtidtmalertemailsentat |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Has Analysis
|
gtidtmalerthasanalysis |
boolean |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Indicator Malicious Score
|
gtidtmalertindicatormaliciousscore |
number |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Labels
|
gtidtmalertlabels |
grid |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Monitor ID
|
gtidtmalertmonitorid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Monitor Name
|
gtidtmalertmonitorname |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Monitor Version
|
gtidtmalertmonitorversion |
number |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Similarity Score
|
gtidtmalertsimilarityscore |
number |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Status
|
gtidtmalertstatus |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Summary
|
gtidtmalertsummary |
longText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Topics
|
gtidtmalerttopics |
grid |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Type
|
gtidtmalerttype |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI DTM Alert Updated At
|
gtidtmalertupdatedat |
date |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert AI Summary
|
gtirsalertaisummary |
markdown |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Audit Create Time
|
gtirsalertauditcreatetime |
date |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Audit Creator
|
gtirsalertauditcreator |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Audit Update Time
|
gtirsalertauditupdatetime |
date |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Audit Updater
|
gtirsalertauditupdater |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Configurations
|
gtirsalertconfigurations |
multiSelect |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Data Leak Discovery Document IDs
|
gtirsalertdataleakdiscoverydocumentids |
multiSelect |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Data Leak Severity
|
gtirsalertdataleakseverity |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Detail Type
|
gtirsalertdetailtype |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Display Name
|
gtirsalertdisplayname |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Duplicate Of
|
gtirsalertduplicateof |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Duplicated By
|
gtirsalertduplicatedby |
multiSelect |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert ETag
|
gtirsalertetag |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert External ID
|
gtirsalertexternalid |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Finding Count
|
gtirsalertfindingcount |
number |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Findings
|
gtirsalertfindings |
multiSelect |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Initial Access Broker Discovery Document IDs
|
gtirsalertinitialaccessbrokerdiscoverydocumentids |
multiSelect |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Initial Access Broker Severity
|
gtirsalertinitialaccessbrokerseverity |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Insider Threat Discovery Document IDs
|
gtirsalertinsiderthreatdiscoverydocumentids |
multiSelect |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Insider Threat Severity
|
gtirsalertinsiderthreatseverity |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Name
|
gtirsalertname |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Priority Analysis Confidence
|
gtirsalertpriorityanalysisconfidence |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Priority Analysis Level
|
gtirsalertpriorityanalysislevel |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Priority Analysis Reasoning
|
gtirsalertpriorityanalysisreasoning |
longText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Relevance Common Themes
|
gtirsalertrelevancecommonthemes |
multiSelect |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Relevance Confidence
|
gtirsalertrelevanceconfidence |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Relevance Distinct Themes
|
gtirsalertrelevancedistinctthemes |
multiSelect |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Relevance Level
|
gtirsalertrelevancelevel |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Relevance Reasoning
|
gtirsalertrelevancereasoning |
longText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Relevance Relevant
|
gtirsalertrelevancerelevant |
boolean |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Severity Analysis Confidence
|
gtirsalertseverityanalysisconfidence |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Severity Analysis Level
|
gtirsalertseverityanalysislevel |
shortText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert Severity Analysis Reasoning
|
gtirsalertseverityanalysisreasoning |
longText |
GoogleThreatIntelligence
|
No |
0 |
|
GTI RS Alert State
|
gtirsalertstate |
singleSelect |
GoogleThreatIntelligence
|
No |
0 |
|
Gatewatcher AionIQ Active CTI case identifier
|
gatewatcherioccaseid |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc campaigns
|
gatewatcherioccampaigns |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc categories
|
gatewatcherioccategories |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc color based level
|
gatewatcherioctlp |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc creation date
|
gatewatcherioccreationdate |
date |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc description
|
gatewatcheriocdescription |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc external links
|
gatewatcheriocexternallinks |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc families
|
gatewatcheriocfamilies |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc kill chain phases
|
gatewatcheriockillchainphases |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc metadata
|
gatewatcheriocmetadata |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc package date
|
gatewatcheriocpackagedate |
date |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc relations
|
gatewatcheriocrelations |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc signature
|
gatewatcheriocsignature |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc tactics techniques and procedures
|
gatewatcheriocttp |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc tags
|
gatewatcherioctags |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc targeted countries
|
gatewatcherioctargetedcountries |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc targeted organizations
|
gatewatcherioctargetedorganizations |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc targeted platforms
|
gatewatcherioctargetedplatforms |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc targeted sectors
|
gatewatcherioctargetedsectors |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc threat actors
|
gatewatcheriocthreatactor |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc type
|
gatewatcherioctype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc updated date
|
gatewatcheriocupdateddate |
date |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc usage mode
|
gatewatcheriocusagemode |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc value
|
gatewatcheriocvalue |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Active CTI ioc vulnerabilities
|
gatewatcheriocvulnerabilities |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Beacon Detect active beacon
|
gatewatcherbeaconactive |
boolean |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Beacon Detect hostname resolution
|
gatewatcherbeaconhostnameresolution |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Beacon Detect identifier
|
gatewatcherbeaconid |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Beacon Detect mean time interval
|
gatewatcherbeaconmeantimeinterval |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Beacon Detect possible cnc
|
gatewatcherbeaconpossiblecnc |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Beacon Detect session count
|
gatewatcherbeaconsessioncount |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Beacon Detect type
|
gatewatcherbeacontype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DCE RPC call number
|
gatewatcherdcerpccallid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DCE RPC request details
|
gatewatcherdcerpcreq |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DCE RPC request type
|
gatewatcherdcerpcrequest |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DCE RPC response details
|
gatewatcherdcerpcres |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DCE RPC response type
|
gatewatcherdcerpcresponse |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DCE RPC rpc version
|
gatewatcherdcerpcrpcversion |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DGA Detect malware confidence percetage
|
gatewatcherdgamalwarebehaviorconfidence |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DGA Detect number of NX domains
|
gatewatcherdganxdomaincount |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DGA Detect number of dga
|
gatewatcherdgadgacount |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DGA Detect ratio of number and NX domains
|
gatewatcherdgadgaratio |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DGA Detect top 10 domains
|
gatewatcherdgatopdga |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP DNS servers
|
gatewatcherdhcpdnsservers |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP assigned IP
|
gatewatcherdhcpassignedip |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP client IP
|
gatewatcherdhcpclientip |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP client MAC
|
gatewatcherdhcpclientmac |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP hostname
|
gatewatcherdhcphostname |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP id
|
gatewatcherdhcpid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP lease time
|
gatewatcherdhcpleasetime |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP next server IP
|
gatewatcherdhcpnextserverip |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP relay IP
|
gatewatcherdhcprelayip |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP request type
|
gatewatcherdhcptype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP routers
|
gatewatcherdhcprouters |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP subnet mask
|
gatewatcherdhcpsubnetmask |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DHCP type
|
gatewatcherdhcpdhcptype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DNP3 application
|
gatewatcherdnp3application |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DNP3 control
|
gatewatcherdnp3control |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DNP3 destination
|
gatewatcherdnp3dst |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DNP3 internal indication points
|
gatewatcherdnp3iin |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DNP3 request type
|
gatewatcherdnp3type |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DNP3 source
|
gatewatcherdnp3src |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DNS answers
|
gatewatcherdnsanswers |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DNS authorities
|
gatewatcherdnsauthorities |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DNS request type
|
gatewatcherdnstype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ DNS response type
|
gatewatcherdnsresponsecode |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ FTP command
|
gatewatcherftpcommand |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ FTP completion codes
|
gatewatcherftpcompletioncode |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ FTP dynamic port
|
gatewatcherftpdynamicport |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ FTP reply
|
gatewatcherftpreply |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ FTP reply received
|
gatewatcherftpreplyreceived |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ FTP reply truncated
|
gatewatcherftpreplytruncated |
boolean |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ GCap
|
gatewatchergcap |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ GCap network interface
|
gatewatchergcapinterface |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ GCenter
|
gatewatchergcenter |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ GCenter WebUI link
|
gatewatchergcenterwebui |
url |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP HTTP referer
|
gatewatcherhttphttprefer |
url |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP HTTP2 details
|
gatewatcherhttphttp2 |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP accept request header
|
gatewatcherhttpaccept |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP date
|
gatewatcherhttpdate |
date |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP hostname
|
gatewatcherhttphostname |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP last modified
|
gatewatcherhttplastmodified |
date |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP protocol
|
gatewatcherhttpversion |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP request MIME type
|
gatewatcherhttprequestmimetype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP request method
|
gatewatcherhttprequestmethod |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP response MIME type
|
gatewatcherhttpresponsemimetype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP response code
|
gatewatcherhttpresponsestatus |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP2 URL
|
gatewatcherhttp2url |
url |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP2 exchange length
|
gatewatcherhttp2length |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP2 http2 details
|
gatewatcherhttp2http2 |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP2 request headers
|
gatewatcherhttp2requestheaders |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP2 request method
|
gatewatcherhttp2httpmethod |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP2 response code
|
gatewatcherhttp2status |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP2 response headers
|
gatewatcherhttp2responseheaders |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP2 user agent
|
gatewatcherhttp2httpuseragent |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ HTTP2 version
|
gatewatcherhttp2version |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 algorithm Diffie Hellman group
|
gatewatcherikev2algdh |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 algorithm Extended Sequence Numbers
|
gatewatcherikev2esn |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 authentication algorithm
|
gatewatcherikev2algauth |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 encryption algorithm
|
gatewatcherikev2algenc |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 exchange type number
|
gatewatcherikev2exchangetype |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 initial Security Parameter Indexes
|
gatewatcherikev2initspi |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 message id
|
gatewatcherikev2messageid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 notify
|
gatewatcherikev2notify |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 number of errors
|
gatewatcherikev2errors |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 payload
|
gatewatcherikev2payload |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 preferred algorithm
|
gatewatcherikev2algperf |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 responder Security Parameter Indexes
|
gatewatcherikev2respspi |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 role
|
gatewatcherikev2role |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 version major
|
gatewatcherikev2versionmajor |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ IKEV2 version minor
|
gatewatcherikev2versionminor |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Kerberos client name
|
gatewatcherkrbcname |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Kerberos encryption algorithm
|
gatewatcherkrbencryption |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Kerberos message type
|
gatewatcherkrbmsgtype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Kerberos realm
|
gatewatcherkrbrealm |
url |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Kerberos service name
|
gatewatcherkrbsname |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Kerberos weak encryption
|
gatewatcherkrbweakencryption |
boolean |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ MQTT CONNACK
|
gatewatchermqttconnack |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Malcore analysis result
|
gatewatchermalcorestate |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Malcore engines last update
|
gatewatchermalcoreengineslastupdatedate |
date |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Malcore file magic
|
gatewatchermalcoremagicdetails |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Malcore ratio of engines on alert
|
gatewatchermalcoretotalfound |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Malcore threat details
|
gatewatchermalcoredetailthreatfound |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Malicious Powershell Detect characters score
|
gatewatchermaliciouspowershellscore |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Malicious Powershell Detect probability of obfuscation
|
gatewatchermaliciouspowershellprobaobfuscated |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ NFS exchange type
|
gatewatchernfstype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ NFS file transmission
|
gatewatchernfsfiletx |
boolean |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ NFS filename
|
gatewatchernfsfilename |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ NFS id
|
gatewatchernfsid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ NFS procedure
|
gatewatchernfsprocedure |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ NFS session hash
|
gatewatchernfshhash |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ NFS status
|
gatewatchernfsstatus |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ NFS version
|
gatewatchernfsversion |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Network Behavior Analytics action policy
|
gatewatchernbaaction |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Network Behavior Analytics base64 packet
|
gatewatchernbapacket |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Network Behavior Analytics base64 payload
|
gatewatchernbapayload |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Network Behavior Analytics category
|
gatewatchernbacategory |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Network Behavior Analytics group id
|
gatewatchernbagid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Network Behavior Analytics metadata
|
gatewatchernbametadata |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Network Behavior Analytics readable payload
|
gatewatchernbapayloadprintable |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Network Behavior Analytics revision
|
gatewatchernbarev |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Network Behavior Analytics signature
|
gatewatchernbasignature |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Network Behavior Analytics signature id
|
gatewatchernbasignatureid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Network Behavior Analytics stream
|
gatewatchernbastream |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ RDP channels
|
gatewatcherrdpchannels |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ RDP client info
|
gatewatcherrdpclient |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ RDP exchange type
|
gatewatcherrdpeventtype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ RDP transmission id
|
gatewatcherrdptxid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ RFB authentication details
|
gatewatcherrfbauthentication |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ RFB client protocol versions
|
gatewatcherrfbclientprotocolversion |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ RFB server protocol versions
|
gatewatcherrfbserverprotocolversion |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ RFB server security failure reason
|
gatewatcherrfbserversecurityfailurereason |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Ransomware Detect alert threshold
|
gatewatcherransomwarealertthreshold |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Ransomware Detect malicious confidence percentage
|
gatewatcherransomwaremaliciousbehaviorconfidence |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Ransomware Detect session score
|
gatewatcherransomwaresessionscore |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Raw Event
|
gatewatcherrawevent |
longText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SIP code
|
gatewatchersipcode |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SIP protocol version
|
gatewatchersipversion |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SIP reason
|
gatewatchersipreason |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SIP response text
|
gatewatchersipresponseline |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMB command
|
gatewatchersmbcommand |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMB exchange status
|
gatewatchersmbstatus |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMB exchange status code
|
gatewatchersmbstatuscode |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMB file UID
|
gatewatchersmbfuid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMB filename
|
gatewatchersmbfilename |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMB id
|
gatewatchersmbid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMB protocol version
|
gatewatchersmbdialect |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMB session id
|
gatewatchersmbsessionid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMB share
|
gatewatchersmbshare |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMB tree id
|
gatewatchersmbtreeid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMTP helo
|
gatewatchersmtphelo |
url |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMTP mail from
|
gatewatchersmtpmailfrom |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SMTP recipients
|
gatewatchersmtprcptto |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SNMP PDU type
|
gatewatchersnmppdutype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SNMP commnunity
|
gatewatchersnmpcomm |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SNMP variables
|
gatewatchersnmpvars |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SNMP version
|
gatewatchersnmpversion |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SSH client details
|
gatewatchersshclient |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ SSH server details
|
gatewatchersshserver |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Shellcode Detect detected encodings
|
gatewatchershellcodeencodings |
multiSelect |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Shellcode Detect type
|
gatewatchershellcodesubtype |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Sigflow action policy
|
gatewatchersigflowaction |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Sigflow alert description
|
gatewatchersigflowcategory |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Sigflow payload base64
|
gatewatchersigflowpayload |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Sigflow payload readable
|
gatewatchersigflowpayloadprintable |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ TFTP filename
|
gatewatchertftpfile |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ TFTP mode
|
gatewatchertftpmode |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ TFTP packet
|
gatewatchertftppacket |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ TLS JA3 fingerprint
|
gatewatchertlsja3 |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ TLS JA3S fingerprint
|
gatewatchertlsja3s |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ TLS SNI
|
gatewatchertlssni |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ TLS client details
|
gatewatchertlsclient |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ TLS protocol version
|
gatewatchertlsversion |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ TLS serial
|
gatewatchertlsserial |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ TLS server details
|
gatewatchertlsserver |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ Transport layer
|
gatewatchernetworktransport |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ event module
|
gatewatchereventmodule |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ file filename
|
gatewatcherfilename |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ file hashes
|
gatewatcherfilehash |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ file magic
|
gatewatcherfilemagic |
shortText |
Gatewatcher AionIQ
|
No |
0 |
|
Gatewatcher AionIQ network flow id
|
gatewatcherflowid |
number |
Gatewatcher AionIQ
|
No |
0 |
|
Gem Account Provider
|
gemaccountprovider |
shortText |
Gem
|
No |
0 |
|
Gem Events Count
|
gemeventscount |
number |
Gem
|
No |
0 |
|
Gem Main Entity ID
|
gemmainentityid |
shortText |
Gem
|
No |
0 |
|
Gem Main Entity Name
|
gemmainentityname |
shortText |
Gem
|
No |
0 |
|
Gem Main Entity Region
|
gemmainentityregion |
shortText |
Gem
|
No |
0 |
|
Gem Main Entity Type
|
gemmainentitytype |
shortText |
Gem
|
No |
0 |
|
Gem TTP ID
|
gemttpid |
shortText |
Gem
|
No |
0 |
|
Gem Threat ID
|
gemthreatid |
shortText |
Gem
|
No |
0 |
|
Gem Verdict
|
gemverdict |
singleSelect |
Gem
|
No |
0 |
|
Generic Export Indicators Service Action
|
genericexportindicatorsserviceaction |
singleSelect |
Generic Export Indicators Service
|
No |
0 |
|
Generic Export Indicators Service Indicators List
|
genericexportindicatorsserviceindicatorslist |
longText |
Generic Export Indicators Service
|
No |
0 |
|
Generic Export Indicators Service Tag
|
genericexportindicatorsservicetag |
shortText |
Generic Export Indicators Service
|
No |
0 |
|
Generic Export Indicators Service Type
|
genericexportindicatorsserviceindicatortype |
singleSelect |
Generic Export Indicators Service
|
No |
0 |
|
Gigamon ThreatINSIGHT Category
|
gigamonthreatinsightcategory |
shortText |
Gigamon ThreatINSIGHT
|
No |
0 |
|
Gigamon ThreatINSIGHT Confidence
|
gigamonthreatinsightconfidence |
shortText |
Gigamon ThreatINSIGHT
|
No |
0 |
|
Gigamon ThreatINSIGHT Status
|
gigamonthreatinsightstatus |
shortText |
Gigamon ThreatINSIGHT
|
No |
0 |
|
Given Name
|
givenname |
shortText |
Common Types
|
No |
0 |
|
Global Directory Visibility
|
globaldirectoryvisibility |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Google Account Status
|
googleaccountstatus |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Google Admin Roles Status
|
googleadminrolesstatus |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Google Cloud SCC Organization ID
|
googlecloudsccorganizationid |
shortText |
Google Cloud SCC
|
No |
0 |
|
Google Display Name
|
googledisplayname |
shortText |
Employee Offboarding
|
No |
0 |
|
Google Dorking Data Classification
|
googledorkingdataclassification |
singleSelect |
Google Dorking
|
No |
0 |
|
Google Dorking Data Owner
|
googledorkingdataowner |
multiSelect |
Google Dorking
|
No |
0 |
|
Google Dorking Data Owner Mail
|
googledorkingdataownermail |
multiSelect |
Google Dorking
|
No |
0 |
|
Google Drive Activity Added Parents
|
googledriveactivityaddedparents |
grid |
Google Drive
|
No |
0 |
|
Google Drive Activity Added Permissions
|
googledriveactivityaddedpermissions |
grid |
Google Drive
|
No |
0 |
|
Google Drive Activity Assigned Current User
|
googledriveactivityassignedcurrentuser |
boolean |
Google Drive
|
No |
0 |
|
Google Drive Activity Assigned Deleted User
|
googledriveactivityassigneddeleteduser |
boolean |
Google Drive
|
No |
0 |
|
Google Drive Activity Assigned Person Name
|
googledriveactivityassignedpersonname |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Assigned Unknown User
|
googledriveactivityassignedunknownuser |
boolean |
Google Drive
|
No |
0 |
|
Google Drive Activity Assignment Subtype
|
googledriveactivityassignmentsubtype |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Copied Folder Type
|
googledriveactivitycopiedfoldertype |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Copied Item Is File
|
googledriveactivitycopieditemisfile |
boolean |
Google Drive
|
No |
0 |
|
Google Drive Activity Copied Item Name
|
googledriveactivitycopieditemname |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Copied Item Title
|
googledriveactivitycopieditemtitle |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Copied Shared Drive Name
|
googledriveactivitycopiedshareddrivename |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Copied Shared Drive Title
|
googledriveactivitycopiedshareddrivetitle |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Created New
|
googledriveactivitycreatednew |
boolean |
Google Drive
|
No |
0 |
|
Google Drive Activity DLP Change Type
|
googledriveactivitydlpchangetype |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Delete Type
|
googledriveactivitydeletetype |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Identified As
|
googledriveactivityidentifiedas |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Mentioned Users
|
googledriveactivitymentionedusers |
grid |
Google Drive
|
No |
0 |
|
Google Drive Activity New Title
|
googledriveactivitynewtitle |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Old Title
|
googledriveactivityoldtitle |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Post Subtype
|
googledriveactivitypostsubtype |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Reference Type
|
googledriveactivityreferencetype |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Removed Parents
|
googledriveactivityremovedparents |
grid |
Google Drive
|
No |
0 |
|
Google Drive Activity Removed Permissions
|
googledriveactivityremovedpermissions |
grid |
Google Drive
|
No |
0 |
|
Google Drive Activity Restore Type
|
googledriveactivityrestoretype |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Restriction Changes
|
googledriveactivityrestrictionchanges |
grid |
Google Drive
|
No |
0 |
|
Google Drive Activity Suggestion Subtype
|
googledriveactivitysuggestionsubtype |
shortText |
Google Drive
|
No |
0 |
|
Google Drive Activity Targets
|
googledriveactivitytargets |
grid |
Google Drive
|
No |
0 |
|
Google Drive Activity Uploaded
|
googledriveactivityuploaded |
boolean |
Google Drive
|
No |
0 |
|
Google Drive Status
|
googledrivestatus |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Google Mail Status
|
googlemailstatus |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Google Password Status
|
googlepasswordstatus |
singleSelect |
Employee Offboarding
|
No |
0 |
|
GoogleCloudSCC Asset DisplayName
|
googlecloudsccassetdisplayname |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding Category
|
googlecloudsccfindingcategory |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding CreateTime
|
googlecloudsccfindingcreatetime |
date |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding EventTime
|
googlecloudsccfindingeventtime |
date |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding ExternalURI
|
googlecloudsccfindingexternaluri |
url |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding FirstDiscovered
|
googlecloudsccfindingfirstdiscovered |
date |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding MostRecentlySeen
|
googlecloudsccfindingmostrecentlyseen |
date |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding Name
|
googlecloudsccfindingname |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding Parent
|
googlecloudsccfindingparent |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties AccessMethod
|
googlecloudsccfindingsourcepropertiesaccessmethod |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Acked
|
googlecloudsccfindingsourcepropertiesacked |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties ActivationTrigger
|
googlecloudsccfindingsourcepropertiesactivationtrigger |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Alert
|
googlecloudsccfindingsourcepropertiesalert |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties AlertType
|
googlecloudsccfindingsourcepropertiesalerttype |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties App
|
googlecloudsccfindingsourcepropertiesapp |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties AppCategory
|
googlecloudsccfindingsourcepropertiesappcategory |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties AppSessionId
|
googlecloudsccfindingsourcepropertiesappsessionid |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Browser
|
googlecloudsccfindingsourcepropertiesbrowser |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Browser Version
|
googlecloudsccfindingsourcepropertiesbrowserversion |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties BrowserSessionId
|
googlecloudsccfindingsourcepropertiesbrowsersessionid |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties CCI
|
googlecloudsccfindingsourcepropertiescci |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties CCL
|
googlecloudsccfindingsourcepropertiesccl |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties ClientBytes
|
googlecloudsccfindingsourcepropertiesclientbytes |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Count
|
googlecloudsccfindingsourcepropertiescount |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Device
|
googlecloudsccfindingsourcepropertiesdevice |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Domain
|
googlecloudsccfindingsourcepropertiesdomain |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties DstCountry
|
googlecloudsccfindingsourcepropertiesdstcountry |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties DstGeoipSrc
|
googlecloudsccfindingsourcepropertiesdstgeoipsrc |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties DstIP
|
googlecloudsccfindingsourcepropertiesdstip |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties DstLocation
|
googlecloudsccfindingsourcepropertiesdstlocation |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties DstRegion
|
googlecloudsccfindingsourcepropertiesdstregion |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties DstTimezone
|
googlecloudsccfindingsourcepropertiesdsttimezone |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties DstZipcode
|
googlecloudsccfindingsourcepropertiesdstzipcode |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties EventType
|
googlecloudsccfindingsourcepropertieseventtype |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties ExceptionInstructions
|
googlecloudsccfindingsourcepropertiesexceptioninstructions |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties ExposedService
|
googlecloudsccfindingsourcepropertiesexposedservice |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties HostName
|
googlecloudsccfindingsourcepropertieshostname |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties ID
|
googlecloudsccfindingsourcepropertiesid |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties InsertionEpochTimestamp
|
googlecloudsccfindingsourcepropertiesinsertionepochtimestamp |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties LastApp
|
googlecloudsccfindingsourcepropertieslastapp |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties LastCountry
|
googlecloudsccfindingsourcepropertieslastcountry |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties LastDevice
|
googlecloudsccfindingsourcepropertieslastdevice |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties LastLocation
|
googlecloudsccfindingsourcepropertieslastlocation |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties LastRegion
|
googlecloudsccfindingsourcepropertieslastregion |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties MfaDetails
|
googlecloudsccfindingsourcepropertiesmfadetails |
markdown |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties NumBytes
|
googlecloudsccfindingsourcepropertiesnumbytes |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties OrganizationUnit
|
googlecloudsccfindingsourcepropertiesorganizationunit |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties OrigTy
|
googlecloudsccfindingsourcepropertiesorigty |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Page
|
googlecloudsccfindingsourcepropertiespage |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties PageDuration
|
googlecloudsccfindingsourcepropertiespageduration |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties PageEndtime
|
googlecloudsccfindingsourcepropertiespageendtime |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties PageId
|
googlecloudsccfindingsourcepropertiespageid |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties PageStarttime
|
googlecloudsccfindingsourcepropertiespagestarttime |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties ProfileId
|
googlecloudsccfindingsourcepropertiesprofileid |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties ProjectId
|
googlecloudsccfindingsourcepropertiesprojectid |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties ReactivationCount
|
googlecloudsccfindingsourcepropertiesreactivationcount |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties ReqCnt
|
googlecloudsccfindingsourcepropertiesreqcnt |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties RespCnt
|
googlecloudsccfindingsourcepropertiesrespcnt |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties RiskLevel
|
googlecloudsccfindingsourcepropertiesrisklevel |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties RiskLevelId
|
googlecloudsccfindingsourcepropertiesrisklevelid |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties ScannerName
|
googlecloudsccfindingsourcepropertiesscannername |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties ServerBytes
|
googlecloudsccfindingsourcepropertiesserverbytes |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Severity
|
googlecloudsccfindingsourcepropertiesseverity |
singleSelect |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties SeverityLevel
|
googlecloudsccfindingsourcepropertiesseveritylevel |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Site
|
googlecloudsccfindingsourcepropertiessite |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties SlcLatitude
|
googlecloudsccfindingsourcepropertiesslclatitude |
number |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties SlcLongitute
|
googlecloudsccfindingsourcepropertiesslclongitute |
number |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties SrcCountry
|
googlecloudsccfindingsourcepropertiessrccountry |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties SrcGeoIpSrc
|
googlecloudsccfindingsourcepropertiessrcgeoipsrc |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties SrcLocation
|
googlecloudsccfindingsourcepropertiessrclocation |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties SrcRegion
|
googlecloudsccfindingsourcepropertiessrcregion |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties SrcTimezone
|
googlecloudsccfindingsourcepropertiessrctimezone |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties SrcZipcode
|
googlecloudsccfindingsourcepropertiessrczipcode |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties TenantName
|
googlecloudsccfindingsourcepropertiestenantname |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Threshold
|
googlecloudsccfindingsourcepropertiesthreshold |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties Timestamp
|
googlecloudsccfindingsourcepropertiestimestamp |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties TrafficType
|
googlecloudsccfindingsourcepropertiestraffictype |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties UrNormalized
|
googlecloudsccfindingsourcepropertiesurnormalized |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties User
|
googlecloudsccfindingsourcepropertiesuser |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties UserAgent
|
googlecloudsccfindingsourcepropertiesuseragent |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties UserGenerated
|
googlecloudsccfindingsourcepropertiesusergenerated |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties UserIP
|
googlecloudsccfindingsourcepropertiesuserip |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding SourceProperties UserKey
|
googlecloudsccfindingsourcepropertiesuserkey |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Finding URL
|
googlecloudsccfindingurl |
url |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Overview
|
googlecloudsccoverview |
longText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Parent Resource ParentDisplayName
|
googlecloudsccparentresourceparentdisplayname |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Recommendation
|
googlecloudsccrecommendation |
longText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Resource Name
|
googlecloudsccresourcename |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Resource ParentDisplayName
|
googlecloudsccresourceparentdisplayname |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Resource ParentName
|
googlecloudsccresourceparentname |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Resource Project DisplayName
|
googlecloudsccresourceprojectdisplayname |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Resource ProjectName
|
googlecloudsccresourceprojectname |
shortText |
Google Cloud SCC
|
No |
0 |
|
GoogleCloudSCC Security Marks
|
googlecloudsccsecuritymarks |
markdown |
Google Cloud SCC
|
No |
0 |
|
Grafana Dashboard Link
|
grafanadashboardlink |
url |
Grafana
|
No |
0 |
|
Grafana Dashboard Uid
|
grafanadashboarduid |
shortText |
Grafana
|
No |
0 |
|
Grafana Panel Id
|
grafanapanelid |
number |
Grafana
|
No |
0 |
|
Grand Parent Process
|
grandparentprocess |
shortText |
CrowdStrike Falcon
|
No |
0 |
|
Graph Plot
|
graphplot |
html |
NTT Cyber Threat Sensor
|
No |
0 |
|
GravityZone Company ID
|
gravityzonecompanyid |
shortText |
GravityZone
|
No |
0 |
|
GravityZone Company Name
|
gravityzonecompanyname |
shortText |
GravityZone
|
No |
0 |
|
GravityZone Computer FQDN
|
gravityzonecomputerfqdn |
shortText |
GravityZone
|
No |
0 |
|
GravityZone Computer ID
|
gravityzonecomputerid |
shortText |
GravityZone
|
No |
0 |
|
GravityZone Computer IP
|
gravityzonecomputerip |
shortText |
GravityZone
|
No |
0 |
|
GravityZone Computer Name
|
gravityzonecomputername |
shortText |
GravityZone
|
No |
0 |
|
GravityZone Incident Action Taken
|
gravityzoneincidentactiontaken |
shortText |
GravityZone
|
No |
0 |
|
GravityZone Incident Assigned User ID
|
gravityzoneincidentassigneduserid |
shortText |
GravityZone
|
No |
0 |
|
GravityZone Incident ID
|
gravityzoneincidentid |
shortText |
GravityZone
|
No |
0 |
|
GravityZone Incident Link
|
gravityzoneincidentlink |
shortText |
GravityZone
|
No |
0 |
|
GravityZone Incident Number
|
gravityzoneincidentnumber |
number |
GravityZone
|
No |
0 |
|
GravityZone Incident Priority
|
gravityzoneincidentpriority |
shortText |
GravityZone
|
No |
0 |
|
GravityZone Incident Severity Score
|
gravityzoneincidentseverityscore |
number |
GravityZone
|
No |
0 |
|
GravityZone Incident Type
|
gravityzoneincidenttype |
singleSelect |
GravityZone
|
No |
0 |
|
Group ID
|
groupid |
shortText |
Common Types
|
No |
0 |
|
GuardiCore Associated Incident Groups
|
guardicoreassociatedincidentgroups |
tagsSelect |
Akamai GuardiCore
|
No |
0 |
|
GuardiCore Incident Type
|
guardicoreincidenttype |
shortText |
Akamai GuardiCore
|
No |
0 |
|
HIPAA Notification
|
hipaanotification |
timer |
HIPAA - Breach Notification
|
No |
0 |
|
HackerOne Report Assignee Disabled
|
hackeronereportassigneedisabled |
boolean |
HackerOne
|
No |
0 |
|
HackerOne Report Assignee HackerOne Triager
|
hackeronereportassigneehackeronetriager |
boolean |
HackerOne
|
No |
0 |
|
HackerOne Report Assignee ID
|
hackeronereportassigneeid |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Assignee Location
|
hackeronereportassigneelocation |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Assignee Name
|
hackeronereportassigneename |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Assignee Reputation
|
hackeronereportassigneereputation |
number |
HackerOne
|
No |
0 |
|
HackerOne Report Assignee Username
|
hackeronereportassigneeusername |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Assignee Website
|
hackeronereportassigneewebsite |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Attack Complexity
|
hackeronereportattackcomplexity |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Attack Vector
|
hackeronereportattackvector |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Disclosed At
|
hackeronereportdisclosedat |
date |
HackerOne
|
No |
0 |
|
HackerOne Report ID
|
hackeronereportid |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Program Handle
|
hackeronereportprogramhandle |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Reporter Disabled
|
hackeronereportreporterdisabled |
boolean |
HackerOne
|
No |
0 |
|
HackerOne Report Reporter HackerOne Triager
|
hackeronereportreporterhackeronetriager |
boolean |
HackerOne
|
No |
0 |
|
HackerOne Report Reporter ID
|
hackeronereportreporterid |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Reporter Location
|
hackeronereportreporterlocation |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Reporter Name
|
hackeronereportreportername |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Reporter Reputation
|
hackeronereportreporterreputation |
number |
HackerOne
|
No |
0 |
|
HackerOne Report Reporter Username
|
hackeronereportreporterusername |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Reporter Website
|
hackeronereportreporterwebsite |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Severity ID
|
hackeronereportseverityid |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Vulnerability Information
|
hackeronereportvulnerabilityinformation |
markdown |
HackerOne
|
No |
0 |
|
HackerOne Report Vulnerable Component Scope
|
hackeronereportvulnerablecomponentscope |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Weakness External ID
|
hackeronereportweaknessexternalid |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Weakness ID
|
hackeronereportweaknessid |
shortText |
HackerOne
|
No |
0 |
|
HackerOne Report Weakness Name
|
hackeronereportweaknessname |
shortText |
HackerOne
|
No |
0 |
|
Handled Techniques
|
handledtechniques |
grid |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
HarfangLab EDR Critical Security Event Count
|
criticalsecurityeventcount |
number |
HarfangLab EDR
|
No |
0 |
|
HarfangLab EDR High Security Event Count
|
highsecurityeventcount |
number |
HarfangLab EDR
|
No |
0 |
|
HarfangLab EDR Low Security Event Count
|
lowsecurityeventcount |
number |
HarfangLab EDR
|
No |
0 |
|
HarfangLab EDR Medium Security Event Count
|
mediumsecurityeventcount |
number |
HarfangLab EDR
|
No |
0 |
|
HarfangLab EDR Threat ID
|
threatid |
shortText |
HarfangLab EDR
|
No |
0 |
|
HarfangLab EDR Top Agents
|
topagents |
multiSelect |
HarfangLab EDR
|
No |
0 |
|
HarfangLab EDR Top Impacted Users
|
topimpactedusers |
multiSelect |
HarfangLab EDR
|
No |
0 |
|
HarfangLab EDR Top Rules
|
toprules |
multiSelect |
HarfangLab EDR
|
No |
0 |
|
HarfangLab EDR Total Security Event Count
|
totalsecurityeventcount |
number |
HarfangLab EDR
|
No |
0 |
|
Health Check Actionable Items
|
healthcheckactionableitems |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Auto Extraction based Incident Type
|
healthcheckautoextractionbasedincidenttype |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Docker Containers
|
healthcheckdockercontainers |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Docker Containers Stats
|
healthcheckdockercontainersstats |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Docker Images
|
healthcheckdockerimages |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Docker Paused
|
healthcheckdockerpaused |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Docker Running
|
healthcheckdockerrunning |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Docker Stop
|
healthcheckdockerstop |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Docker Version
|
healthcheckdockerversion |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Enabled Instances
|
healthcheckenabledinstances |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check File System Directories
|
healthcheckfilesystemdirectories |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Incidents Large Number Of Entries
|
healthcheckincidentslargenumberofentries |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Installed Packs
|
healthcheckinstalledpacks |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Investigations With Large Input / Output
|
healthcheckinvestigationswithlargeinputoutput |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Large Files
|
healthchecklargefiles |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Large Investigations
|
healthchecklargeinvestigations |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Log Since
|
healthchecklogsince |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Log Until
|
healthcheckloguntil |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Number Of Dropped Incidents
|
healthchecknumberofdroppedincidents |
number |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Number Of Engines
|
healthchecknumberofengines |
number |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Number of investigations bigger than 1MB
|
healthchecknumberofinvestigationsbiggerthan1mb |
number |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Number of investigations input / output bigger than 1MB
|
healthchecknumberofinvestigationsinputoutputbiggerthan1mb |
number |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Panics
|
healthcheckpanics |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Permitted Users
|
healthcheckpermittedusers |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Restart Count
|
healthcheckrestartcount |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Risky Indexed Fields
|
healthcheckriskyindexedfields |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Top Used Playbooks
|
healthchecktopusedplaybooks |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Total Outdated Packs
|
healthchecktotaloutdatedpacks |
number |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Total Packs Installed
|
healthchecktotalpacksinstalled |
number |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Used Users
|
healthcheckusedusers |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Workers Busy
|
healthcheckworkersbusy |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health Check Workers Total
|
healthcheckworkerstotal |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Health insurance breached
|
healthinsurancebreached |
shortText |
Common Scripts
|
No |
0 |
|
Hello World ID
|
helloworldid |
shortText |
HelloWorld
|
No |
0 |
|
Hello World Status
|
helloworldstatus |
shortText |
HelloWorld
|
No |
0 |
|
Hello World Type
|
helloworldtype |
shortText |
HelloWorld
|
No |
0 |
|
HelloWorld OnPrem
|
helloworldonprem |
shortText |
HelloWorld
|
No |
0 |
|
HelloWorld SaaS
|
helloworldsaas |
shortText |
HelloWorld
|
No |
0 |
|
High Level Categories
|
highlevelcategories |
multiSelect |
Common Types
|
No |
0 |
|
High Risky Hosts
|
highriskyhosts |
multiSelect |
Common Types
|
No |
0 |
|
High Risky Users
|
highriskyusers |
multiSelect |
Common Types
|
No |
0 |
|
Highlights
|
highlights |
shortText |
Intel471 Feed
|
No |
0 |
|
Host FQDN
|
hostfqdn |
shortText |
Core Alert Fields
|
No |
0 |
|
Host IP
|
hostip |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Host Mac Address
|
hostmacaddress |
shortText |
Core Alert Fields
|
No |
0 |
|
Host Name
|
hostname |
shortText |
Malware Core
|
No |
0 |
|
Host OS
|
hostos |
singleSelect |
Core Alert Fields
|
No |
0 |
|
Host Risk Level
|
hostrisklevel |
shortText |
Core Alert Fields
|
No |
0 |
|
Host Risk Reasons
|
hostriskreasons |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Hostname
|
hostname |
shortText |
Core Alert Fields
|
No |
0 |
|
Hostnames
|
hostnames |
multiSelect |
Common Types
|
No |
0 |
|
How could information sharing with other organizations have been improved?
|
howcouldinformationsharingwithotherorganizationshavebeenimproved |
shortText |
NIST
|
No |
0 |
|
How was the incident contained and eradicated?
|
howwastheincidentcontainedanderadicated |
shortText |
SANS
|
No |
0 |
|
How well did staff and management perform in dealing with the incident? Were the documented procedures followed? Were they adequate?
|
howwelldidstaffandmanagementperformindealingwiththeincidentwerethedocumentedproceduresfollowedweretheyadequate |
shortText |
NIST
|
No |
0 |
|
Hox External Classification
|
hoxexternalclassification |
singleSelect |
Hoxhunt
|
No |
0 |
|
Hox FT Attachments
|
hoxftattachments |
markdown |
Hoxhunt
|
No |
0 |
|
Hox FT Body Link
|
hoxftbodylink |
url |
Hoxhunt
|
No |
0 |
|
Hox FT Email From
|
hoxftemailfrom |
shortText |
Hoxhunt
|
No |
0 |
|
Hox FT Email To
|
hoxftemailto |
shortText |
Hoxhunt
|
No |
0 |
|
Hox FT ID
|
hoxftid |
shortText |
Hoxhunt
|
No |
0 |
|
Hox FT Internal Classification
|
hoxftinternalclassification |
shortText |
Hoxhunt
|
No |
0 |
|
Hox FT Links
|
hoxftlinks |
markdown |
Hoxhunt
|
No |
0 |
|
Hox FT Maliciousness Probability
|
hoxftmaliciousnessprobability |
shortText |
Hoxhunt
|
No |
0 |
|
Hox FT Message Id
|
hoxftmessageid |
shortText |
Hoxhunt
|
No |
0 |
|
Hox FT Subject
|
hoxftsubject |
shortText |
Hoxhunt
|
No |
0 |
|
Hox First Reported At
|
hoxfirstreportedat |
shortText |
Hoxhunt
|
No |
0 |
|
Hox Global Report Count
|
hoxglobalreportcount |
number |
Hoxhunt
|
No |
0 |
|
Hox Has Sensitive Information
|
hoxhassensitiveinformation |
boolean |
Hoxhunt
|
No |
0 |
|
Hox ID
|
hoxid |
shortText |
Hoxhunt
|
No |
0 |
|
Hox Inbox Report Count
|
hoxinboxreportcount |
number |
Hoxhunt
|
No |
0 |
|
Hox Incident Rule Actions
|
hoxincidentruleactions |
markdown |
Hoxhunt
|
No |
0 |
|
Hox Internal Classification
|
hoxinternalclassification |
singleSelect |
Hoxhunt
|
No |
0 |
|
Hox Last Reported At
|
hoxlastreportedat |
shortText |
Hoxhunt
|
No |
0 |
|
Hox Likely Target Entity
|
hoxlikelytargetentity |
shortText |
Hoxhunt
|
No |
0 |
|
Hox Message To Users
|
hoxmessagetousers |
shortText |
Hoxhunt
|
No |
0 |
|
Hox Notes
|
hoxnotes |
markdown |
Hoxhunt
|
No |
0 |
|
Hox Phish Report Count
|
hoxphishreportcount |
number |
Hoxhunt
|
No |
0 |
|
Hox Report Count
|
hoxreportcount |
number |
Hoxhunt
|
No |
0 |
|
Hox Reported At Limit
|
hoxreportedatlimit |
singleSelect |
Hoxhunt
|
No |
0 |
|
Hox Send Feedback
|
hoxsendfeedback |
boolean |
Hoxhunt
|
No |
0 |
|
Hox State
|
hoxstate |
singleSelect |
Hoxhunt
|
No |
0 |
|
Hox Threat Indicators
|
hoxthreatindicators |
tagsSelect |
Hoxhunt
|
No |
0 |
|
Hox URL
|
hoxurl |
url |
Hoxhunt
|
No |
0 |
|
Hox User Actions
|
hoxuseractions |
tagsSelect |
Hoxhunt
|
No |
0 |
|
Hox VIP Report Count
|
hoxvipreportcount |
number |
Hoxhunt
|
No |
0 |
|
Hunt Results Count
|
huntresultscount |
shortText |
Common Types
|
No |
0 |
|
Hunting Endpoint Enrichment
|
huntingendpointenrichment |
shortText |
Proactive Threat Hunting
|
No |
0 |
|
Hunting Session Status
|
huntingsessionstatus |
shortText |
Proactive Threat Hunting
|
No |
0 |
|
Hunting Task Count
|
huntingtaskcount |
shortText |
Rapid Breach Response
|
No |
0 |
|
IBM Security QRadar SOAR Artifacts
|
ibmsecurityqradarsoarartifacts |
multiSelect |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Attachments
|
ibmsecurityqradarsoarattachments |
multiSelect |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Criminal Activity
|
ibmsecurityqradarsoarcriminalactivity |
shortText |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Discovered Date
|
ibmsecurityqradarsoardiscovereddate |
date |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Exposure Type
|
ibmsecurityqradarsoarexposuretype |
shortText |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR NIST Attack Vectors
|
ibmsecurityqradarsoarnistattackvectors |
multiSelect |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Name
|
ibmsecurityqradarsoarname |
shortText |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Negative PR
|
ibmsecurityqradarsoarnegativepr |
boolean |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Notes
|
ibmsecurityqradarsoarnotes |
multiSelect |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Phase
|
ibmsecurityqradarsoarphase |
shortText |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Reporter Name
|
ibmsecurityqradarsoarreportername |
shortText |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Resolution
|
ibmsecurityqradarsoarresolution |
shortText |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Resolution Summary
|
ibmsecurityqradarsoarresolutionsummary |
longText |
IBM Security QRadar SOAR
|
No |
0 |
|
IBM Security QRadar SOAR Tasks
|
ibmsecurityqradarsoartasks |
multiSelect |
IBM Security QRadar SOAR
|
No |
0 |
|
ID - Asset
|
idasset |
multiSelect |
Asset
|
No |
0 |
|
ID - Offense
|
idoffense |
number |
IBM QRadar
|
No |
0 |
|
IP Address - Asset
|
ipaddressasset |
multiSelect |
Asset
|
No |
0 |
|
IP Blocked Status
|
ipblockedstatus |
shortText |
Common Types
|
No |
0 |
|
IP Reputation
|
ipreputation |
shortText |
Common Types
|
No |
0 |
|
Identity Table
|
identitytable |
markdown |
Identity
|
No |
0 |
|
Identity Type
|
identitytype |
multiSelect |
Common Types
|
No |
0 |
|
IllusionBLACK Attack Type
|
illusionblackattacktype |
shortText |
Smokescreen IllusionBLACK
|
No |
0 |
|
IllusionBLACK Attacker ID
|
illusionblackattackerid |
shortText |
Smokescreen IllusionBLACK
|
No |
0 |
|
IllusionBLACK Decoy ID
|
illusionblackdecoyid |
shortText |
Smokescreen IllusionBLACK
|
No |
0 |
|
IllusionBLACK Events
|
illusionblackevents |
grid |
Smokescreen IllusionBLACK
|
No |
0 |
|
IllusionBLACK Threat Parse
|
illusionblackthreatparse |
markdown |
Smokescreen IllusionBLACK
|
No |
0 |
|
Illusive Networks Deception Families
|
illusivenetworksdeceptionfamilies |
shortText |
Illusive Networks
|
No |
0 |
|
Illusive Networks Events Number
|
illusivenetworkseventsnumber |
number |
Illusive Networks
|
No |
0 |
|
Illusive Networks Has Forensics
|
illusivenetworkshasforensics |
boolean |
Illusive Networks
|
No |
0 |
|
Illusive Networks Host Name
|
illusivenetworkshostname |
shortText |
Illusive Networks
|
No |
0 |
|
Illusive Networks Id
|
illusivenetworksid |
shortText |
Illusive Networks
|
No |
0 |
|
Illusive Networks Last Seen User
|
illusivenetworkslastseenuser |
shortText |
Illusive Networks
|
No |
0 |
|
Illusive Networks Source Operating System
|
illusivenetworkssourceoperatingsystem |
shortText |
Illusive Networks
|
No |
0 |
|
Illusive Networks Steps To Crown Jewel
|
illusivenetworksstepstocrownjewel |
number |
Illusive Networks
|
No |
0 |
|
Illusive Networks Steps To Domain Admin
|
illusivenetworksstepstodomainadmin |
number |
Illusive Networks
|
No |
0 |
|
Image Name
|
imagename |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Impact Remediation Products
|
impactremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Incident Duration
|
incidentduration |
timer |
Common Types
|
No |
0 |
|
Incident Link
|
incidentlink |
url |
Common Types
|
No |
0 |
|
Incident Response Process
|
incidentresponseprocess |
markdown |
Use Case Builder
|
No |
0 |
|
Incident Structure and Mapping
|
incidentstructureandmapping |
markdown |
Use Case Builder
|
No |
0 |
|
Incidents Info
|
incidentsinfo |
markdown |
Phishing Campaign
|
No |
0 |
|
IncomingMirrorError
|
incomingmirrorerror |
longText |
Common Types
|
No |
0 |
|
Indeni Device ID
|
indenideviceid |
shortText |
Indeni
|
No |
0 |
|
Indeni Issue ID
|
indeniissueid |
shortText |
Indeni
|
No |
0 |
|
Individuals Notification
|
individualsnotification |
singleSelect |
Common Scripts
|
No |
0 |
|
Infected Hostnames
|
infectedhostnames |
shortText |
Port Scan
|
No |
0 |
|
Infected Hosts
|
infectedhosts |
grid |
Malware Core
|
No |
0 |
|
Infinipoint hostname
|
infinipointhostname |
shortText |
Infinipoint
|
No |
0 |
|
Infinipoint policyID
|
infinipointpolicyid |
shortText |
Infinipoint
|
No |
0 |
|
Infinipoint policyName
|
infinipointpolicyname |
shortText |
Infinipoint
|
No |
0 |
|
Infoblox Cloud Application Category
|
infobloxcloudapplicationcategory |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Application Name
|
infobloxcloudapplicationname |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Category
|
infobloxcloudcategory |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Confidence
|
infobloxcloudconfidence |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud DHCP Fingerprint
|
infobloxclouddhcpfingerprint |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud DNS View
|
infobloxclouddnsview |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Endpoint Groups
|
infobloxcloudendpointgroups |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Event Count
|
infobloxcloudeventcount |
number |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Event Not Blocked Count
|
infobloxcloudeventnotblockedcount |
number |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Event Time
|
infobloxcloudeventtime |
date |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Feed Name
|
infobloxcloudfeedname |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Feed Source
|
infobloxcloudfeedsource |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Feed Type
|
infobloxcloudfeedtype |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Insight Changed Time
|
infobloxcloudinsightchangedtime |
date |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Insight ID
|
infobloxcloudinsightid |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Insight Most Recent Time
|
infobloxcloudinsightmostrecenttime |
date |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Insight Persistent Time
|
infobloxcloudinsightpersistenttime |
date |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Insight Priority
|
infobloxcloudinsightpriority |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Insight Spreading Time
|
infobloxcloudinsightspreadingtime |
date |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Insight Start Time
|
infobloxcloudinsightstarttime |
date |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Insight Status
|
infobloxcloudinsightstatus |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Network
|
infobloxcloudnetwork |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Private IP
|
infobloxcloudprivateip |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud QIP
|
infobloxcloudqip |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud QNAME
|
infobloxcloudqname |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud QTYPE
|
infobloxcloudqtype |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud RCODE
|
infobloxcloudrcode |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud RDATA
|
infobloxcloudrdata |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud RIP
|
infobloxcloudrip |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Severity
|
infobloxcloudseverity |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Threat Class
|
infobloxcloudthreatclass |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Threat Family
|
infobloxcloudthreatfamily |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Threat Indicator
|
infobloxcloudthreatindicator |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Threat Property
|
infobloxcloudthreatproperty |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud Threat Type
|
infobloxcloudthreattype |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud User
|
infobloxclouduser |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Infoblox Cloud User Groups
|
infobloxcloudusergroups |
shortText |
Infoblox Threat Defense with DDI
|
No |
0 |
|
Initial Access Remediation Products
|
initialaccessremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Initiated By
|
initiatedby |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Initiator CMD
|
initiatorcmd |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Initiator MD5
|
initiatormd5 |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Initiator PID
|
initiatorpid |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Initiator SHA256
|
initiatorsha256 |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Initiator TID
|
initiatortid |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Initiator path
|
initiatorpath |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Initiator signature
|
initiatorsignature |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Initiator signer
|
initiatorsigner |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Instance Name
|
instancename |
singleSelect |
Troubleshoot
|
No |
0 |
|
Integrations Categories
|
integrationscategories |
multiSelect |
Integrations & Incidents Health Check
|
No |
0 |
|
Integrations Failed Categories
|
integrationsfailedcategories |
multiSelect |
Integrations & Incidents Health Check
|
No |
0 |
|
Integrations Test Grid
|
integrationstestgrid |
grid |
Integrations & Incidents Health Check
|
No |
0 |
|
Intel 471 URL
|
intel471url |
url |
Intel471 Feed
|
No |
0 |
|
Internal Addresses
|
internaladdresses |
shortText |
Common Types
|
No |
0 |
|
Inventa Credit Card Number
|
inventacreditcardnumber |
shortText |
Inventa
|
No |
0 |
|
Inventa DSAR DataAssets
|
inventadsardataassets |
grid |
Inventa
|
No |
0 |
|
Inventa DSAR DataBases
|
inventadsardatabases |
grid |
Inventa
|
No |
0 |
|
Inventa DSAR DataSubject Email
|
inventadsardatasubjectemail |
shortText |
Inventa
|
No |
0 |
|
Inventa DSAR DataSubject ID
|
inventadsardatasubjectid |
shortText |
Inventa
|
No |
0 |
|
Inventa DSAR DataSubject Name
|
inventadsardatasubjectname |
shortText |
Inventa
|
No |
0 |
|
Inventa DSAR Files
|
inventadsarfiles |
grid |
Inventa
|
No |
0 |
|
Inventa DSAR Inventa Ticket
|
inventadsarinventaticket |
shortText |
Inventa
|
No |
0 |
|
Inventa DSAR PII Entities
|
inventadsarpiientities |
grid |
Inventa
|
No |
0 |
|
Inventa DSAR Transactions
|
inventadsartransactions |
grid |
Inventa
|
No |
0 |
|
Inventa Driver License
|
inventadriverlicense |
shortText |
Inventa
|
No |
0 |
|
Inventa National ID
|
inventanationalid |
shortText |
Inventa
|
No |
0 |
|
Inventa PII Entities
|
inventapiientities |
tagsSelect |
Inventa
|
No |
0 |
|
Inventa Passport Number
|
inventapassportnumber |
shortText |
Inventa
|
No |
0 |
|
Inventa Report Reason
|
inventareportreason |
shortText |
Inventa
|
No |
0 |
|
Inventa Source
|
inventasource |
grid |
Inventa
|
No |
0 |
|
Inventa Tax ID
|
inventataxid |
shortText |
Inventa
|
No |
0 |
|
Inventa Vehicle Number
|
inventavehiclenumber |
shortText |
Inventa
|
No |
0 |
|
Investigation Stage
|
investigationstage |
shortText |
Common Types
|
No |
0 |
|
IoT Incident URL
|
iotincidenturl |
url |
IoT by Palo Alto Networks
|
No |
0 |
|
IronDefense Aggregation Criteria
|
irondefenseaggregationcriteria |
shortText |
IronNet
|
No |
0 |
|
IronDefense Alert ID
|
irondefensealertid |
shortText |
IronNet
|
No |
0 |
|
IronDefense Alert IDs
|
irondefensealertids |
shortText |
IronNet
|
No |
0 |
|
IronDefense Analyst Expectation
|
irondefenseanalystexpectation |
singleSelect |
IronNet
|
No |
0 |
|
IronDefense Analyst Severity
|
irondefenseanalystseverity |
singleSelect |
IronNet
|
No |
0 |
|
IronDefense App Domains
|
irondefenseappdomains |
shortText |
IronNet
|
No |
0 |
|
IronDefense Bytes In
|
irondefensebytesin |
number |
IronNet
|
No |
0 |
|
IronDefense Bytes Out
|
irondefensebytesout |
number |
IronNet
|
No |
0 |
|
IronDefense Category
|
irondefensecategory |
singleSelect |
IronNet
|
No |
0 |
|
IronDefense Comment Details
|
irondefensecommentdetails |
shortText |
IronNet
|
No |
0 |
|
IronDefense Confidence
|
irondefenseconfidence |
shortText |
IronNet
|
No |
0 |
|
IronDefense Created
|
irondefensecreated |
date |
IronNet
|
No |
0 |
|
IronDefense Dome Shared Time
|
irondefensedomesharedtime |
date |
IronNet
|
No |
0 |
|
IronDefense Dome Tags
|
irondefensedometags |
shortText |
IronNet
|
No |
0 |
|
IronDefense Dst Entity Attribute
|
irondefensedstentityattribute |
shortText |
IronNet
|
No |
0 |
|
IronDefense Dst Entity Attribute Type
|
irondefensedstentityattributetype |
singleSelect |
IronNet
|
No |
0 |
|
IronDefense Dst IP
|
irondefensedstip |
shortText |
IronNet
|
No |
0 |
|
IronDefense Dst Network ID
|
irondefensedstnetworkid |
shortText |
IronNet
|
No |
0 |
|
IronDefense Dst Port
|
irondefensedstport |
number |
IronNet
|
No |
0 |
|
IronDefense End Time
|
irondefenseendtime |
date |
IronNet
|
No |
0 |
|
IronDefense Event Count
|
irondefenseeventcount |
number |
IronNet
|
No |
0 |
|
IronDefense Event ID
|
irondefenseeventid |
shortText |
IronNet
|
No |
0 |
|
IronDefense First Event Created
|
irondefensefirsteventcreated |
date |
IronNet
|
No |
0 |
|
IronDefense High Cognitive System Details
|
irondefensehighcognitivesystemdetails |
shortText |
IronNet
|
No |
0 |
|
IronDefense IronDome Category
|
irondefenseirondomecategory |
singleSelect |
IronNet
|
No |
0 |
|
IronDefense IronDome ID
|
irondefenseirondomeid |
shortText |
IronNet
|
No |
0 |
|
IronDefense Is Blacklisted
|
irondefenseisblacklisted |
boolean |
IronNet
|
No |
0 |
|
IronDefense Is Whitelisted
|
irondefenseiswhitelisted |
boolean |
IronNet
|
No |
0 |
|
IronDefense Last event Created
|
irondefenselasteventcreated |
date |
IronNet
|
No |
0 |
|
IronDefense Mismatch Details
|
irondefensemismatchdetails |
shortText |
IronNet
|
No |
0 |
|
IronDefense Primary App Protocol
|
irondefenseprimaryappprotocol |
shortText |
IronNet
|
No |
0 |
|
IronDefense Raw Data Format
|
irondefenserawdataformat |
multiSelect |
IronNet
|
No |
0 |
|
IronDefense Secondary App Protocol
|
irondefensesecondaryappprotocol |
shortText |
IronNet
|
No |
0 |
|
IronDefense Severity
|
irondefenseseverity |
number |
IronNet
|
No |
0 |
|
IronDefense Severity Details
|
irondefenseseveritydetails |
shortText |
IronNet
|
No |
0 |
|
IronDefense Severity Malicious Details
|
irondefenseseveritymaliciousdetails |
shortText |
IronNet
|
No |
0 |
|
IronDefense Severity Suspicious Details
|
irondefenseseveritysuspiciousdetails |
shortText |
IronNet
|
No |
0 |
|
IronDefense Src Entity Attribute
|
irondefensesrcentityattribute |
shortText |
IronNet
|
No |
0 |
|
IronDefense Src Entity Attribute Type
|
irondefensesrcentityattributetype |
singleSelect |
IronNet
|
No |
0 |
|
IronDefense Src IP
|
irondefensesrcip |
shortText |
IronNet
|
No |
0 |
|
IronDefense Src Network ID
|
irondefensesrcnetworkid |
shortText |
IronNet
|
No |
0 |
|
IronDefense Start Time
|
irondefensestarttime |
date |
IronNet
|
No |
0 |
|
IronDefense Status
|
irondefensestatus |
singleSelect |
IronNet
|
No |
0 |
|
IronDefense SubCategory
|
irondefensesubcategory |
shortText |
IronNet
|
No |
0 |
|
IronDefense Total Bytes
|
irondefensetotalbytes |
number |
IronNet
|
No |
0 |
|
IronDefense Updated
|
irondefenseupdated |
date |
IronNet
|
No |
0 |
|
IronDefense VUE URL
|
irondefensevueurl |
url |
IronNet
|
No |
0 |
|
Ironscales-Choose-Classification
|
ironscaleschooseclassification |
singleSelect |
Ironscales
|
No |
0 |
|
Ironscales-Classification
|
ironscalesclassification |
shortText |
Ironscales
|
No |
0 |
|
Ironscales-Details
|
ironscalesdetails |
grid |
Ironscales
|
No |
0 |
|
Ironscales-ID
|
ironscalesid |
shortText |
Ironscales
|
No |
0 |
|
Ironscales-Links
|
ironscaleslinks |
longText |
Ironscales
|
No |
0 |
|
Ironscales-Resolver-email-address
|
ironscalesresolveremailaddress |
shortText |
Ironscales
|
No |
0 |
|
Ironscales-affected_mailbox_count
|
ironscalesaffectedmailboxcount |
shortText |
Ironscales
|
No |
0 |
|
Ironscales-attachments
|
ironscalesattachments |
longText |
Ironscales
|
No |
0 |
|
Ironscales-banner_displayed
|
ironscalesbannerdisplayed |
longText |
Ironscales
|
No |
0 |
|
Ironscales-company_id
|
ironscalescompanyid |
shortText |
Ironscales
|
No |
0 |
|
Ironscales-company_name
|
ironscalescompanyname |
shortText |
Ironscales
|
No |
0 |
|
Ironscales-federation
|
ironscalesfederation |
longText |
Ironscales
|
No |
0 |
|
Ironscales-first_reported_by
|
ironscalesfirstreportedby |
shortText |
Ironscales
|
No |
0 |
|
Ironscales-first_reported_date
|
ironscalesfirstreporteddate |
shortText |
Ironscales
|
No |
0 |
|
Ironscales-mail_server
|
ironscalesmailserver |
longText |
Ironscales
|
No |
0 |
|
Ironscales-reply_to
|
ironscalesreplyto |
longText |
Ironscales
|
No |
0 |
|
Ironscales-reports
|
ironscalesreports |
longText |
Ironscales
|
No |
0 |
|
Ironscales-sender_email
|
ironscalessenderemail |
shortText |
Ironscales
|
No |
0 |
|
Ironscales-sender_is_internal
|
ironscalessenderisinternal |
boolean |
Ironscales
|
No |
0 |
|
Ironscales-sender_reputation
|
ironscalessenderreputation |
shortText |
Ironscales
|
No |
0 |
|
Ironscales-spf_Result
|
ironscalesspfresult |
shortText |
Ironscales
|
No |
0 |
|
Ironscales-themis_proba
|
ironscalesthemisproba |
number |
Ironscales
|
No |
0 |
|
Ironscales-themis_verdict
|
ironscalesthemisverdict |
shortText |
Ironscales
|
No |
0 |
|
Ironscales_incident_id
|
ironscalesincidentid |
shortText |
Ironscales
|
No |
0 |
|
Is Active
|
isactive |
singleSelect |
Common Types
|
No |
0 |
|
Is Phishing
|
isphishing |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Is VPN IP Address
|
isvpnipaddress |
boolean |
Cloud Incident Response
|
No |
0 |
|
Is the Data Subject to DPIA
|
isthedatasubjecttodpia |
shortText |
Common Scripts
|
No |
0 |
|
Isolated
|
isolated |
shortText |
Common Types
|
No |
0 |
|
Item Owner
|
itemowner |
shortText |
Common Types
|
No |
0 |
|
Item Owner Email
|
itemowneremail |
shortText |
Common Types
|
No |
0 |
|
Jira Attachments
|
jiraattachments |
attachments |
Atlassian Jira
|
No |
0 |
|
Jira Comment
|
jiracomment |
longText |
Atlassian Jira
|
No |
0 |
|
Jira Component
|
jiracomponent |
tagsSelect |
Atlassian Jira
|
No |
0 |
|
Jira Description
|
jiradescription |
shortText |
Atlassian Jira
|
No |
0 |
|
Jira Due Date
|
jiraduedate |
shortText |
Atlassian Jira
|
No |
0 |
|
Jira Estimate
|
jiraestimate |
shortText |
Atlassian Jira
|
No |
0 |
|
Jira ID
|
jiraid |
number |
Atlassian Jira
|
No |
0 |
|
Jira Issue Key
|
jiraissuekey |
shortText |
Atlassian Jira
|
No |
0 |
|
Jira Issue Type
|
jiraissuetype |
shortText |
Atlassian Jira
|
No |
0 |
|
Jira Labels
|
jiralabels |
tagsSelect |
Atlassian Jira
|
No |
0 |
|
Jira Priority
|
jirapriority |
shortText |
Atlassian Jira
|
No |
0 |
|
Jira Project
|
jiraproject |
shortText |
Atlassian Jira
|
No |
0 |
|
Jira Reporter Email
|
jirareporteremail |
shortText |
Atlassian Jira
|
No |
0 |
|
Jira Reporter Name
|
jirareportername |
shortText |
Atlassian Jira
|
No |
0 |
|
Jira Status
|
jirastatus |
shortText |
Atlassian Jira
|
No |
0 |
|
Jira Subtask
|
jirasubtask |
longText |
Atlassian Jira
|
No |
0 |
|
Jira Summary
|
jirasummary |
shortText |
Atlassian Jira
|
No |
0 |
|
Jira Transitions
|
jiratransitions |
singleSelect |
Atlassian Jira
|
No |
0 |
|
JiraV3 Status
|
jirav3status |
singleSelect |
Atlassian Jira
|
No |
0 |
|
Job Code
|
jobcode |
shortText |
Common Types
|
No |
0 |
|
Job Family
|
jobfamily |
shortText |
Common Types
|
No |
0 |
|
Job Function
|
jobfunction |
shortText |
Common Types
|
No |
0 |
|
Jobs Created
|
jobscreated |
grid |
XSOAR CI/CD
|
No |
0 |
|
KELA RaDark Details
|
kelaradarkdetails |
shortText |
KELA RaDark
|
No |
0 |
|
KELA RaDark Incident URL
|
kelaradarkincidenturl |
url |
KELA RaDark
|
No |
0 |
|
KELA RaDark Monitor ID
|
kelaradarkmonitorid |
shortText |
KELA RaDark
|
No |
0 |
|
KELA RaDark Sub Type
|
kelaradarksubtype |
shortText |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Agressor
|
kelaradarktableagressor |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Botnets
|
kelaradarktablebotnets |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Credit Cards
|
kelaradarktablecreditcards |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Credit Cards From Instant Messaging
|
kelaradarktablecreditcardsfrominstantmessaging |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Hacking Discussions
|
kelaradarktablehackingdiscussions |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Information Disclosure
|
kelaradarktableinformationdisclosure |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Leaked Credentials From Citadel
|
kelaradarktableleakedcredentialsfromcitadel |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Leaked Credentials From Dump
|
kelaradarktableleakedcredentialsfromdump |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Leaked Credentials From Hacking Discussions
|
kelaradarktableleakedcredentialsfromhackingdiscussions |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Leaked Credentials From Instant Messaging
|
kelaradarktableleakedcredentialsfrominstantmessaging |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Russian Market
|
kelaradarktablerussianmarket |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Sensitive Hosts
|
kelaradarktablesensitivehosts |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table TwoEasy
|
kelaradarktabletwoeasy |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Vulnerable Services Database
|
kelaradarktablevulnerableservicesdatabase |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Vulnerable Services File Sharing
|
kelaradarktablevulnerableservicesfilesharing |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Vulnerable Services Insecure Network Services
|
kelaradarktablevulnerableservicesinsecurenetworkservices |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Vulnerable Services Message Broker
|
kelaradarktablevulnerableservicesmessagebroker |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Vulnerable Services Remote Control
|
kelaradarktablevulnerableservicesremotecontrol |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Vulnerable Services SCADA
|
kelaradarktablevulnerableservicesscada |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Vulnerable Technologies
|
kelaradarktablevulnerabletechnologies |
grid |
KELA RaDark
|
No |
0 |
|
KELA RaDark Table Web Applications Vulnerabilities
|
kelaradarktablewebapplicationsvulnerabilities |
grid |
KELA RaDark
|
No |
0 |
|
Lacework Event Actor
|
laceworkeventactor |
shortText |
Lacework
|
No |
0 |
|
Lacework Event ID
|
laceworkeventid |
shortText |
Lacework
|
No |
0 |
|
Lacework Event Model
|
laceworkeventmodel |
shortText |
Lacework
|
No |
0 |
|
Lacework Event Type
|
laceworkeventtype |
shortText |
Lacework
|
No |
0 |
|
Lacework Recommendation Account Alias
|
laceworkrecommendationaccountalias |
shortText |
Lacework
|
No |
0 |
|
Lacework Recommendation Account ID
|
laceworkrecommendationaccountid |
shortText |
Lacework
|
No |
0 |
|
Lacework Recommendation ID
|
laceworkrecommendationid |
shortText |
Lacework
|
No |
0 |
|
Lacework Recommendation Title
|
laceworkrecommendationtitle |
shortText |
Lacework
|
No |
0 |
|
Last Mirrored Time Stamp
|
lastmirroredtimestamp |
date |
Common Types
|
No |
0 |
|
Last Modified By
|
lastmodifiedby |
shortText |
Common Types
|
No |
0 |
|
Last Modified On
|
lastmodifiedon |
shortText |
Common Types
|
No |
0 |
|
Last Name
|
lastname |
shortText |
Common Types
|
No |
0 |
|
Last Seen
|
lastseen |
shortText |
Common Types
|
No |
0 |
|
Last Update Time
|
lastupdatetime |
shortText |
Common Types
|
No |
0 |
|
LastMirroredInTime
|
lastmirroredintime |
date |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
Lateral Movement Remediation Products
|
lateralmovementremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Leadership
|
leadership |
shortText |
Common Types
|
No |
0 |
|
Likely Impact
|
likelyimpact |
shortText |
Common Scripts
|
No |
0 |
|
Link To Offense
|
linktooffense |
url |
IBM QRadar
|
No |
0 |
|
List Of Rules - Event
|
listofrulesevent |
multiSelect |
Common Types
|
No |
0 |
|
List of Rules - Offense
|
listofrulesoffense |
multiSelect |
IBM QRadar
|
No |
0 |
|
Lists Created
|
listscreated |
grid |
XSOAR CI/CD
|
No |
0 |
|
Local IP
|
localip |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Local Port
|
localport |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Location
|
location |
shortText |
Common Types
|
No |
0 |
|
Location - Asset
|
locationasset |
multiSelect |
Asset
|
No |
0 |
|
Location Region
|
locationregion |
shortText |
Common Types
|
No |
0 |
|
Log Source
|
logsource |
shortText |
Common Types
|
No |
0 |
|
Log Source Name
|
logsourcename |
multiSelect |
Common Types
|
No |
0 |
|
Log Source Type
|
logsourcetype |
multiSelect |
Common Types
|
No |
0 |
|
LogPoint AlertObjId
|
logpointalertobjid |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Assigned To
|
logpointassignedto |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Comments
|
logpointcomments |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Comments Count
|
logpointcommentscount |
number |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Detection Timestamp
|
logpointdetectiontimestamp |
number |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint IncidentId
|
logpointincidentid |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Last Action
|
logpointlastaction |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint LogPoint Name
|
logpointlogpointname |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Loginspect IP DNS
|
logpointloginspectipdns |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Object ID
|
logpointobjectid |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Query
|
logpointquery |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Repos
|
logpointrepos |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Rows Count
|
logpointrowscount |
number |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Status
|
logpointstatus |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Throttle Enabled
|
logpointthrottleenabled |
boolean |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Tid
|
logpointtid |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Time Range
|
logpointtimerange |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint User Id
|
logpointuserid |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Username
|
logpointusername |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogPoint Visible To
|
logpointvisibleto |
shortText |
LogPoint SIEM Integration
|
No |
0 |
|
LogRhythm Associated Cases
|
logrhythmassociatedcases |
shortText |
LogRhythm
|
No |
0 |
|
LogRhythm Case Collaborators
|
logrhythmcollaborators |
shortText |
LogRhythm
|
No |
0 |
|
LogRhythm Case Priority
|
logrhythmpriority |
number |
LogRhythm
|
No |
0 |
|
LogRhythm Case Updated User
|
logrhythmcaseupdateduser |
shortText |
LogRhythm
|
No |
0 |
|
LogRhythm Entity
|
logrhythmentity |
shortText |
LogRhythm
|
No |
0 |
|
LogRhythm Status
|
logrhythmstatus |
shortText |
LogRhythm
|
No |
0 |
|
LogRhythm Ticket Due Date
|
logrhythmticketduedate |
date |
LogRhythm
|
No |
0 |
|
Login Attempt Count
|
loginattemptcount |
number |
Brute Force
|
No |
0 |
|
Logz.Io Alert ID
|
logzioalertid |
shortText |
Logz.io
|
No |
0 |
|
Logz.io Alert Event ID
|
logzioalerteventid |
shortText |
Logz.io
|
No |
0 |
|
Logz.io Alert Summary
|
logzioalertsummary |
shortText |
Logz.io
|
No |
0 |
|
Logz.io Tags
|
logziotags |
multiSelect |
Logz.io
|
No |
0 |
|
Low Level Categories - Offense
|
lowlevelcategoriesoffense |
multiSelect |
IBM QRadar
|
No |
0 |
|
Low Level Categories Events
|
lowlevelcategoriesevents |
multiSelect |
Common Types
|
No |
0 |
|
M-ASM Category
|
masmcategory |
shortText |
Mandiant Advantage Attack Surface Management
|
No |
0 |
|
M-ASM Collection
|
masmcollection |
shortText |
Mandiant Advantage Attack Surface Management
|
No |
0 |
|
M-ASM Confirmed
|
masmconfirmed |
boolean |
Mandiant Advantage Attack Surface Management
|
No |
0 |
|
M-ASM Description
|
masmdescription |
longText |
Mandiant Advantage Attack Surface Management
|
No |
0 |
|
M-ASM Entity Name
|
masmentityname |
shortText |
Mandiant Advantage Attack Surface Management
|
No |
0 |
|
M-ASM Project
|
masmproject |
shortText |
Mandiant Advantage Attack Surface Management
|
No |
0 |
|
M-ASM Remediation
|
masmremediation |
longText |
Mandiant Advantage Attack Surface Management
|
No |
0 |
|
MAC Address
|
macaddress |
shortText |
Common Types
|
No |
0 |
|
MAC Address - Asset
|
macaddressasset |
multiSelect |
Asset
|
No |
0 |
|
MAD Accounts
|
madaccounts |
grid |
Mandiant Automated Defense
|
No |
0 |
|
MAD Asset Criticality
|
madassetcriticality |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Assets
|
madassets |
grid |
Mandiant Automated Defense
|
No |
0 |
|
MAD Assigned Users
|
madassignedusers |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Attack Stage
|
madattackstage |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Attack Tactic
|
madattacktactic |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Close URL
|
madcloseurl |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Description
|
maddescription |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Domains
|
maddomains |
grid |
Mandiant Automated Defense
|
No |
0 |
|
MAD Escalation Reasons
|
madescalationreasons |
grid |
Mandiant Automated Defense
|
No |
0 |
|
MAD Event Count
|
madeventcount |
number |
Mandiant Automated Defense
|
No |
0 |
|
MAD External Systems
|
madexternalsystems |
grid |
Mandiant Automated Defense
|
No |
0 |
|
MAD External Tenant Id
|
madexternaltenantid |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Feedback Comments
|
madfeedbackcomments |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Feedback Outcome
|
madfeedbackoutcome |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Feedback Time Updated
|
madfeedbacktimeupdated |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Feedback User Id
|
madfeedbackuserid |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD File Hashes
|
madfilehashes |
grid |
Mandiant Automated Defense
|
No |
0 |
|
MAD First Event Time
|
madfirsteventtime |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Incident Id
|
madincidentid |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Internal Tenant Id
|
madinternaltenantid |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Last Event Time
|
madlasteventtime |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Malware
|
madmalware |
grid |
Mandiant Automated Defense
|
No |
0 |
|
MAD Probability
|
madprobability |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Signatures
|
madsignatures |
grid |
Mandiant Automated Defense
|
No |
0 |
|
MAD Status
|
madstatus |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD Time Generated
|
madtimegenerated |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MAD URL
|
madurl |
shortText |
Mandiant Automated Defense
|
No |
0 |
|
MD5
|
md5 |
shortText |
Common Types
|
No |
0 |
|
MITRE Caldera Delete Operation
|
calderadeleteoperation |
boolean |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Adversary ID
|
calderaoperationadversaryid |
singleSelect |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Auto Close
|
calderaoperationautoclose |
singleSelect |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Autonomy
|
calderaoperationautonomy |
singleSelect |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Group
|
calderaoperationgroup |
shortText |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Host Group
|
calderaoperationhostgroup |
shortText |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation ID
|
calderaoperationid |
shortText |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Jitter
|
calderaoperationjitter |
shortText |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Name
|
calderaoperationname |
shortText |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Obfuscator
|
calderaoperationobfuscator |
singleSelect |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Objective ID
|
calderaoperationobjectiveid |
singleSelect |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Planner ID
|
calderaoperationplannerid |
singleSelect |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Source ID
|
calderaoperationsourceid |
singleSelect |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation State
|
calderaoperationstate |
singleSelect |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Use Learning Parsers
|
calderaoperationuselearningparsers |
singleSelect |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Operation Visbility
|
calderaoperationvisibility |
shortText |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Schedule Date Time
|
calderascheduledatetime |
date |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Schedule Date Time SLA
|
calderascheduledatetimesla |
timer |
MITRE Caldera
|
No |
0 |
|
MITRE Caldera Schedule Operation
|
calderascheduleoperation |
boolean |
MITRE Caldera
|
No |
0 |
|
MITRE Tactic ID
|
mitretacticid |
multiSelect |
Common Types
|
No |
0 |
|
MITRE Tactic Name
|
mitretacticname |
multiSelect |
Common Types
|
No |
0 |
|
MITRE Technique ID
|
mitretechniqueid |
multiSelect |
Common Types
|
No |
0 |
|
MITRE Technique Name
|
mitretechniquename |
multiSelect |
Common Types
|
No |
0 |
|
Macro Source Code
|
macrosourcecode |
longText |
Common Types
|
No |
0 |
|
Magnitude - Offense
|
magnitudeoffense |
number |
IBM QRadar
|
No |
0 |
|
Mailbox Delegation
|
mailboxdelegation |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Malicious Behavior
|
maliciousbehavior |
shortText |
Malware Core
|
No |
0 |
|
Malicious Cause (If the cause is a malicious attack)
|
maliciouscauseifthecauseisamaliciousattack |
multiSelect |
Common Scripts
|
No |
0 |
|
Malicious Domains Blocked
|
maliciousdomainsblocked |
boolean |
Port Scan
|
No |
0 |
|
Malicious URL Clicked
|
maliciousurlclicked |
shortText |
Phishing
|
No |
0 |
|
Malicious URL Viewed
|
maliciousurlviewed |
shortText |
Phishing
|
No |
0 |
|
Malware Detailed Investigation Summary
|
malwaredetailedinvestigationsummary |
shortText |
Malware Investigation and Response
|
No |
0 |
|
Malware Family
|
malwarefamily |
shortText |
Malware Core
|
No |
0 |
|
Malware Investigation Summary
|
malwareinvestigationsummary |
shortText |
Malware Investigation and Response
|
No |
0 |
|
Malware Name
|
malwarename |
shortText |
Malware Core
|
No |
0 |
|
Management Notification
|
managementnotification |
singleSelect |
Common Scripts
|
No |
0 |
|
Manager Email
|
manageremail |
shortText |
Crisis Management
|
No |
0 |
|
Manager Email Address
|
manageremailaddress |
shortText |
Common Types
|
No |
0 |
|
Manager Name
|
managername |
shortText |
Common Types
|
No |
0 |
|
Manual Steps
|
manualsteps |
markdown |
Use Case Builder
|
No |
0 |
|
Marketplace Packs Installed
|
marketplacepacksinstalled |
grid |
XSOAR CI/CD
|
No |
0 |
|
Measures to Mitigate
|
measurestomitigate |
shortText |
Common Scripts
|
No |
0 |
|
Media Notification
|
medianotification |
singleSelect |
Common Scripts
|
No |
0 |
|
Medical Information breached
|
medicalinformationbreached |
shortText |
Common Scripts
|
No |
0 |
|
Message
|
message |
longText |
Nutanix Hypervisor
|
No |
0 |
|
Microsoft 365 Defender A
|
microsoft365defendera |
grid |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender Active
|
microsoft365defenderactive |
shortText |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender Categories count
|
microsoft365defendercategoriescount |
grid |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender Classification
|
microsoft365defenderclassification |
singleSelect |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender Comments
|
microsoft365defendercomments |
grid |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender Devices
|
microsoft365defenderdevices |
grid |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender Display Name
|
microsoft365defenderdisplayname |
shortText |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender First activity
|
microsoft365defenderfirstactivity |
shortText |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender ID
|
microsoft365defenderid |
number |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender Last activity
|
microsoft365defenderlastactivity |
shortText |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender Mailboxes
|
microsoft365defendermailboxes |
grid |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender Status
|
microsoft365defenderstatus |
singleSelect |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender Tags
|
microsoft365defendertags |
tagsSelect |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft 365 Defender Users
|
microsoft365defenderusers |
grid |
Microsoft 365 Defender
|
No |
0 |
|
Microsoft Defender for Endpoint Evidence Creation Time
|
microsoftdefenderforendpointevidencecreationtime |
multiSelect |
Microsoft Defender for Endpoint
|
No |
0 |
|
Microsoft Defender for Endpoint Evidence Type
|
microsoftdefenderforendpointevidencetype |
multiSelect |
Microsoft Defender for Endpoint
|
No |
0 |
|
Microsoft Graph Identity and Access Activity
|
microsoftgraphidentityandaccessactivity |
shortText |
Microsoft Graph Identity and Access
|
No |
0 |
|
Microsoft Graph Identity and Access Alert Type
|
microsoftgraphidentityandaccessalerttype |
shortText |
Microsoft Graph Identity and Access
|
No |
0 |
|
Microsoft Graph Identity and Access Detected Date Time
|
microsoftgraphidentityandaccessdetecteddatetime |
shortText |
Microsoft Graph Identity and Access
|
No |
0 |
|
Microsoft Graph Identity and Access Detection Timing Type
|
microsoftgraphidentityandaccessdetectiontimingtype |
shortText |
Microsoft Graph Identity and Access
|
No |
0 |
|
Microsoft Graph Identity and Access Token Issuer Type
|
microsoftgraphidentityandaccesstokenissuertype |
shortText |
Microsoft Graph Identity and Access
|
No |
0 |
|
Microsoft Graph Security Alert Determination
|
microsoftgraphsecurityalertdetermination |
shortText |
Microsoft Graph Security
|
No |
0 |
|
Microsoft Graph Security Alert Evidence
|
microsoftgraphsecurityalertevidence |
markdown |
Microsoft Graph Security
|
No |
0 |
|
Microsoft Graph Security Comment
|
microsoftgraphsecuritycomment |
multiSelect |
Microsoft Graph Security
|
No |
0 |
|
Microsoft Graph Security Detector Id
|
microsoftgraphsecuritydetectorid |
shortText |
Microsoft Graph Security
|
No |
0 |
|
Microsoft Graph Security Id
|
microsoftgraphsecurityid |
shortText |
Microsoft Graph Security
|
No |
0 |
|
Microsoft Graph Security Recommended Action
|
microsoftgraphsecurityrecommendedaction |
shortText |
Microsoft Graph Security
|
No |
0 |
|
Microsoft Graph Security Service Source
|
microsoftgraphsecurityservicesource |
shortText |
Microsoft Graph Security
|
No |
0 |
|
Microsoft Sentinel Alert Count
|
microsoftsentinelalertcount |
shortText |
Microsoft Sentinel
|
No |
0 |
|
Microsoft Sentinel Alerts
|
microsoftsentinelalerts |
longText |
Microsoft Sentinel
|
No |
0 |
|
Microsoft Sentinel Classification Comment
|
microsoftsentinelclassificationcomment |
shortText |
Microsoft Sentinel
|
No |
0 |
|
Microsoft Sentinel Classification Reason
|
microsoftsentinelclassificationreason |
singleSelect |
Microsoft Sentinel
|
No |
0 |
|
Microsoft Sentinel Comments
|
microsoftsentinelcomments |
longText |
Microsoft Sentinel
|
No |
0 |
|
Microsoft Sentinel Entities
|
microsoftsentinelentities |
longText |
Microsoft Sentinel
|
No |
0 |
|
Microsoft Sentinel Incident Number
|
microsoftsentinelincidentnumber |
shortText |
Microsoft Sentinel
|
No |
0 |
|
Microsoft Sentinel Owner
|
microsoftsentinelowner |
grid |
Microsoft Sentinel
|
No |
0 |
|
Microsoft Sentinel Relations
|
microsoftsentinelrelations |
longText |
Microsoft Sentinel
|
No |
0 |
|
Microsoft Sentinel Rule Id
|
microsoftsentinelruleid |
multiSelect |
Microsoft Sentinel
|
No |
0 |
|
Misc
|
misc |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Mitigation Task Count
|
mitigationtaskcount |
shortText |
Rapid Breach Response
|
No |
0 |
|
Mitre ATT&CK Tactic
|
mitreattcktactic |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Mitre ATT&CK Technique
|
mitreattcktechnique |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Mobile Device Model
|
mobiledevicemodel |
shortText |
Common Types
|
No |
0 |
|
Mobile Phone
|
mobilephone |
shortText |
Common Types
|
No |
0 |
|
MobileIron Compliance State
|
mobileironcompliancestate |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron Device Alt Serial Number
|
mobileirondevicealtserialnumber |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron Device ID
|
mobileirondeviceid |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron Device Owner
|
mobileirondeviceowner |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron Device Registration Status
|
mobileirondeviceregistrationstatus |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron Device Registration Timestamp
|
mobileirondeviceregistrationtimestamp |
date |
MobileIron-UEM
|
No |
0 |
|
MobileIron Device Serial Number
|
mobileirondeviceserialnumber |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron Device UDID
|
mobileirondeviceudid |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron Device UUID
|
mobileirondeviceuuid |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron Device User ID
|
mobileirondeviceuserid |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron IMEI
|
mobileironimei |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron IMSI
|
mobileironimsi |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron Is Device Jailbroken?
|
mobileironisdevicejailbroken |
boolean |
MobileIron-UEM
|
No |
0 |
|
MobileIron Is Device Quarantined?
|
mobileironisdevicequarantined |
boolean |
MobileIron-UEM
|
No |
0 |
|
MobileIron Last Check-in Timestamp
|
mobileironlastcheckintimestamp |
date |
MobileIron-UEM
|
No |
0 |
|
MobileIron Manufacturer
|
mobileironmanufacturer |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron Platform
|
mobileironplatform |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron Security State
|
mobileironsecuritystate |
shortText |
MobileIron-UEM
|
No |
0 |
|
MobileIron User Email Address
|
mobileironuseremailaddress |
shortText |
MobileIron-UEM
|
No |
0 |
|
Module
|
module |
multiSelect |
Core Alert Fields
|
No |
0 |
|
NCSC Assessment Status
|
ncscassessmentstatus |
shortText |
NCSC Cyber Asssessment Framework
|
No |
0 |
|
NGFW Vsys Name
|
ngfwvsysname |
multiSelect |
Core Alert Fields
|
No |
0 |
|
NIST Stage
|
niststage |
shortText |
NIST
|
No |
0 |
|
Neosec Endpoints
|
neosecendpoints |
grid |
Neosec
|
No |
0 |
|
Neosec Entities
|
neosecentities |
grid |
Neosec
|
No |
0 |
|
Neosec Labels
|
neoseclabels |
multiSelect |
Neosec
|
No |
0 |
|
Neosec Recommendations
|
neosecrecommendations |
longText |
Neosec
|
No |
0 |
|
Netscout Arbor Sightline Alert Type
|
netscoutarborsightlinealerttype |
shortText |
Netscout Arbor Sightline
|
No |
0 |
|
Netskope Access Method
|
netskopeaccessmethod |
shortText |
Netskope
|
No |
0 |
|
Netskope Acknowledge
|
netskopeacknowledge |
boolean |
Netskope
|
No |
0 |
|
Netskope Action
|
netskopeaction |
shortText |
Netskope
|
No |
0 |
|
Netskope Behavior Analytics Policy
|
netskopebehavioranalyticspolicy |
shortText |
Netskope
|
No |
0 |
|
Netskope Breach Date
|
netskopebreachdate |
date |
Netskope
|
No |
0 |
|
Netskope Breach Description
|
netskopebreachdescription |
shortText |
Netskope
|
No |
0 |
|
Netskope Breach Score
|
netskopebreachscore |
number |
Netskope
|
No |
0 |
|
Netskope Breach Source
|
netskopebreachsource |
shortText |
Netskope
|
No |
0 |
|
Netskope Cloud Confidence Level
|
netskopecloudconfidencelevel |
shortText |
Netskope
|
No |
0 |
|
Netskope DLP Policy
|
netskopedlppolicy |
shortText |
Netskope
|
No |
0 |
|
Netskope DLP Profile
|
netskopedlpprofile |
shortText |
Netskope
|
No |
0 |
|
Netskope DLP Rule
|
netskopedlprule |
shortText |
Netskope
|
No |
0 |
|
Netskope File Type
|
netskopefiletype |
shortText |
Netskope
|
No |
0 |
|
Netskope Leak ID
|
netskopeleakid |
shortText |
Netskope
|
No |
0 |
|
Netskope Malware ID
|
netskopemalwareid |
shortText |
Netskope
|
No |
0 |
|
Netskope Malware Name
|
netskopemalwarename |
shortText |
Netskope
|
No |
0 |
|
Netskope Malware Type
|
netskopemalwaretype |
shortText |
Netskope
|
No |
0 |
|
Netskope Object
|
netskopeobject |
shortText |
Netskope
|
No |
0 |
|
Netskope Object ID
|
netskopeobjectid |
shortText |
Netskope
|
No |
0 |
|
Netskope Object Type
|
netskopeobjecttype |
shortText |
Netskope
|
No |
0 |
|
Netskope Original Severity
|
netskopeoriginalseverity |
shortText |
Netskope
|
No |
0 |
|
Netskope Original Status
|
netskopeoriginalstatus |
shortText |
Netskope
|
No |
0 |
|
Netskope Quarantine File ID
|
netskopequarantinefileid |
shortText |
Netskope
|
No |
0 |
|
Netskope Quarantine Policy
|
netskopequarantinepolicy |
shortText |
Netskope
|
No |
0 |
|
Netskope Quarantine Profile
|
netskopequarantineprofile |
shortText |
Netskope
|
No |
0 |
|
Netskope Quarantine Profile ID
|
netskopequarantineprofileid |
shortText |
Netskope
|
No |
0 |
|
Netskope Severity
|
netskopeseverity |
singleSelect |
Netskope
|
No |
0 |
|
Netskope Site
|
netskopesite |
shortText |
Netskope
|
No |
0 |
|
Netskope Timestamp
|
netskopetimestamp |
shortText |
Netskope
|
No |
0 |
|
Netskope Violations
|
netskopeviolations |
number |
Netskope
|
No |
0 |
|
Network Security IDS
|
networksecurityids |
markdown |
Use Case Builder
|
No |
0 |
|
Notable - ID
|
notableid |
shortText |
Splunk
|
No |
0 |
|
Notable Drilldown
|
notabledrilldown |
markdown |
Splunk
|
No |
0 |
|
Notable Owner
|
notableowner |
user |
Splunk
|
No |
0 |
|
Notable Status
|
notablestatus |
singleSelect |
Splunk
|
No |
0 |
|
Notable Urgency
|
notableurgency |
singleSelect |
Splunk
|
No |
0 |
|
Number Of Events In Offense
|
numberofeventsinoffense |
number |
IBM QRadar
|
No |
0 |
|
Number Of Fetched Events
|
numberoffetchedevents |
number |
IBM QRadar
|
No |
0 |
|
Number Of Flows
|
numberofflows |
number |
IBM QRadar
|
No |
0 |
|
Number Of Found Related Alerts
|
numberoffoundrelatedalerts |
number |
Common Types
|
No |
0 |
|
Number Of Log Sources
|
numberoflogsources |
number |
Common Types
|
No |
0 |
|
Number of Entries ID Errors
|
numberofentriesiderrors |
number |
Integrations & Incidents Health Check
|
No |
0 |
|
Number of Failed Incidents
|
numberoffailedincidents |
number |
Integrations & Incidents Health Check
|
No |
0 |
|
Number of Ports
|
numberofports |
number |
Port Scan
|
No |
0 |
|
Number of Related Incidents
|
numberofrelatedincidents |
number |
Common Types
|
No |
0 |
|
Number of Unique Ports
|
numberofuniqueports |
number |
Port Scan
|
No |
0 |
|
Number of similar files
|
numberofsimilarfiles |
number |
Common Types
|
No |
0 |
|
OS
|
os |
shortText |
Common Types
|
No |
0 |
|
OS Parent CMD
|
osparentcmd |
multiSelect |
Core Alert Fields
|
No |
0 |
|
OS Parent ID
|
osparentid |
multiSelect |
Core Alert Fields
|
No |
0 |
|
OS Parent Name
|
osparentname |
multiSelect |
Core Alert Fields
|
No |
0 |
|
OS Parent PID
|
osparentpid |
multiSelect |
Core Alert Fields
|
No |
0 |
|
OS Parent SHA256
|
osparentsha256 |
multiSelect |
Core Alert Fields
|
No |
0 |
|
OS Parent Signature
|
osparentsignature |
multiSelect |
Core Alert Fields
|
No |
0 |
|
OS Parent Signer
|
osparentsigner |
multiSelect |
Core Alert Fields
|
No |
0 |
|
OS Parent User Name
|
osparentusername |
multiSelect |
Core Alert Fields
|
No |
0 |
|
OS Type
|
ostype |
shortText |
Common Types
|
No |
0 |
|
OS Version
|
osversion |
shortText |
Common Types
|
No |
0 |
|
OTSecurity Protocols
|
otsecurityprotocols |
grid |
OTSecurity
|
No |
0 |
|
OTSecurity Substation Contact
|
otsecuritysubstationcontact |
shortText |
OTSecurity
|
No |
0 |
|
OTSecurity Substation Location
|
otsecuritysubstationlocation |
shortText |
OTSecurity
|
No |
0 |
|
OTSecurity Substation Name
|
otsecuritysubstationname |
shortText |
OTSecurity
|
No |
0 |
|
Objective
|
objective |
multiSelect |
Common Types
|
No |
0 |
|
Offboarding Date
|
offboardingdate |
date |
Employee Offboarding
|
No |
0 |
|
Offboarding Stage
|
offboardingstage |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Offense Inactive
|
offenseinactive |
boolean |
IBM QRadar
|
No |
0 |
|
Okta Account Status
|
oktaaccountstatus |
singleSelect |
Employee Offboarding
|
No |
0 |
|
Operation Name
|
operationname |
multiSelect |
Common Types
|
No |
0 |
|
Operation Type
|
operationtype |
shortText |
Nutanix Hypervisor
|
No |
0 |
|
OpsGenie AlertId
|
opsgeniealertid |
shortText |
OpsGenie
|
No |
0 |
|
OpsGenie Alias
|
opsgeniealias |
shortText |
OpsGenie
|
No |
0 |
|
OpsGenie Count Linked Alerts
|
opsgeniecountlinkedalerts |
shortText |
OpsGenie
|
No |
0 |
|
OpsGenie Responder
|
opsgenieresponder |
shortText |
OpsGenie
|
No |
0 |
|
OpsGenie TinyId
|
opsgenietinyid |
shortText |
OpsGenie
|
No |
0 |
|
Orca Alert ID
|
orcaalertid |
shortText |
Orca
|
No |
0 |
|
Orca Asset Unique ID
|
orcaassetuniqueid |
shortText |
Orca
|
No |
0 |
|
Orca Cloud Account
|
orcacloudaccount |
shortText |
Orca
|
No |
0 |
|
Orca Reason
|
orcareason |
shortText |
Orca
|
No |
0 |
|
Org Level 1
|
orglevel1 |
shortText |
Common Types
|
No |
0 |
|
Org Level 2
|
orglevel2 |
shortText |
Common Types
|
No |
0 |
|
Org Level 3
|
orglevel3 |
shortText |
Common Types
|
No |
0 |
|
Org Unit
|
orgunit |
shortText |
Common Types
|
No |
0 |
|
Original Alert ID
|
originalalertid |
shortText |
Common Types
|
No |
0 |
|
Original Alert Name
|
originalalertname |
shortText |
Common Types
|
No |
0 |
|
Original Alert Source
|
originalalertsource |
shortText |
Common Types
|
No |
0 |
|
Original Description
|
originaldescription |
shortText |
Common Types
|
No |
0 |
|
Original Events
|
originalevents |
multiSelect |
Common Types
|
No |
0 |
|
Other PII data breached
|
otherpiidatabreached |
shortText |
Common Scripts
|
No |
0 |
|
Out of the office
|
outoftheoffice |
grid |
Shift Management
|
No |
0 |
|
OutgoingMirrorError
|
outgoingmirrorerror |
longText |
Common Types
|
No |
0 |
|
PAN DLP Action
|
pandlpaction |
shortText |
Enterprise DLP by Palo Alto Networks
|
No |
0 |
|
PAN DLP Channel
|
pandlpchannel |
shortText |
Enterprise DLP by Palo Alto Networks
|
No |
0 |
|
PAN DLP Data Profile Name
|
pandlpdataprofilename |
shortText |
Enterprise DLP by Palo Alto Networks
|
No |
0 |
|
PAN DLP Incident Feedback
|
pandlpincidentfeedback |
shortText |
Enterprise DLP by Palo Alto Networks
|
No |
0 |
|
PAN DLP Incident ID
|
pandlpincidentid |
shortText |
Enterprise DLP by Palo Alto Networks
|
No |
0 |
|
PAN DLP Incident Region
|
pandlpincidentregion |
shortText |
Enterprise DLP by Palo Alto Networks
|
No |
0 |
|
PAN DLP Previous Feedback
|
pandlppreviousfeedback |
shortText |
Enterprise DLP by Palo Alto Networks
|
No |
0 |
|
PAN DLP Report ID
|
pandlpreportid |
shortText |
Enterprise DLP by Palo Alto Networks
|
No |
0 |
|
PAN DLP Tenant ID
|
pandlptenantid |
shortText |
Enterprise DLP by Palo Alto Networks
|
No |
0 |
|
PAN-OS Port Based Rules
|
panosportbasedrules |
markdown |
PAN-OS Policy Optimizer (beta)
|
No |
0 |
|
PAN-OS Rules with Unused Applications
|
panosruleswithunusedapplications |
markdown |
PAN-OS Policy Optimizer (beta)
|
No |
0 |
|
PAN-OS Unused Rules
|
panosunusedrules |
markdown |
PAN-OS Policy Optimizer (beta)
|
No |
0 |
|
PCAP Encryption key
|
pcapencryptionkey |
attachments |
PCAP Analysis
|
No |
0 |
|
PCAP End Time
|
pcapendtime |
shortText |
PCAP Analysis
|
No |
0 |
|
PCAP File Name
|
pcapfilename |
shortText |
PCAP Analysis
|
No |
0 |
|
PCAP File Size
|
pcapfilesize |
shortText |
PCAP Analysis
|
No |
0 |
|
PCAP Flows
|
pcapflows |
grid |
PCAP Analysis
|
No |
0 |
|
PCAP Number Of Packets
|
pcapnumberofpackets |
number |
PCAP Analysis
|
No |
0 |
|
PCAP Number Of Streams
|
pcapnumberofstreams |
number |
PCAP Analysis
|
No |
0 |
|
PCAP Start Time
|
pcapstarttime |
shortText |
PCAP Analysis
|
No |
0 |
|
PCAP file
|
pcapfile |
attachments |
PCAP Analysis
|
No |
0 |
|
PID
|
pid |
shortText |
Common Types
|
No |
0 |
|
PII Data Type
|
piidatatype |
shortText |
Common Scripts
|
No |
0 |
|
PP Ticket Due Date
|
ppticketduedate |
date |
FireMon Security Manager
|
No |
0 |
|
Panorays Finding Asset Name
|
panoraysfindingassetname |
shortText |
Panorays
|
No |
0 |
|
Panorays Finding CVEs
|
panoraysfindingcves |
longText |
Panorays
|
No |
0 |
|
Panorays Finding Category
|
panoraysfindingcategory |
shortText |
Panorays
|
No |
0 |
|
Panorays Finding Description
|
panoraysfindingdescription |
longText |
Panorays
|
No |
0 |
|
Panorays Finding ID
|
panoraysfindingid |
shortText |
Panorays
|
No |
0 |
|
Panorays Finding Insert Timestamp
|
panoraysfindinginsertts |
shortText |
Panorays
|
No |
0 |
|
Panorays Finding Severity
|
panoraysfindingseverity |
shortText |
Panorays
|
No |
0 |
|
Panorays Finding Status
|
panoraysfindingstatus |
shortText |
Panorays
|
No |
0 |
|
Panorays Finding Sub Category
|
panoraysfindingsubcategory |
shortText |
Panorays
|
No |
0 |
|
Panorays Finding Test Name
|
panoraysfindingstestname |
shortText |
Panorays
|
No |
0 |
|
Panorays Finding Text
|
panoraysfindingfindingtext |
longText |
Panorays
|
No |
0 |
|
Panorays Finding Update Timestamp
|
panoraysfindingupdatets |
shortText |
Panorays
|
No |
0 |
|
Parent CMD line
|
parentcmdline |
multiSelect |
Common Types
|
No |
0 |
|
Parent Process
|
parentprocess |
multiSelect |
Common Types
|
No |
0 |
|
Parent Process CMD
|
parentprocesscmd |
multiSelect |
Common Types
|
No |
0 |
|
Parent Process File Path
|
parentprocessfilepath |
multiSelect |
Common Types
|
No |
0 |
|
Parent Process ID
|
parentprocessid |
shortText |
Malware Core
|
No |
0 |
|
Parent Process IDs
|
parentprocessids |
multiSelect |
Common Types
|
No |
0 |
|
Parent Process MD5
|
parentprocessmd5 |
multiSelect |
Common Types
|
No |
0 |
|
Parent Process Name
|
parentprocessname |
multiSelect |
Common Types
|
No |
0 |
|
Parent Process Path
|
parentprocesspath |
multiSelect |
Common Types
|
No |
0 |
|
Parent Process SHA256
|
parentprocesssha256 |
multiSelect |
Common Types
|
No |
0 |
|
Part of Campaign
|
partofcampaign |
shortText |
Common Types
|
No |
0 |
|
Participants
|
participants |
grid |
ExtraHop Reveal(x)
|
No |
0 |
|
Password Changed Date
|
passwordchangeddate |
shortText |
Common Types
|
No |
0 |
|
Password Expiration Status
|
passwordexpirationstatus |
shortText |
Brute Force
|
No |
0 |
|
Password Reset Successfully
|
passwordresetsuccessfully |
boolean |
Common Types
|
No |
0 |
|
Pentera Operation Details
|
penteraoperationdetails |
grid |
Pentera
|
No |
0 |
|
Persistence Remediation Products
|
persistenceremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Personal Email
|
personalemail |
shortText |
Common Types
|
No |
0 |
|
PhishER Action Status
|
phisheractionstatus |
shortText |
PhishER
|
No |
0 |
|
PhishER Attachments
|
phisherattachments |
markdown |
PhishER
|
No |
0 |
|
PhishER Category
|
phishercategory |
shortText |
PhishER
|
No |
0 |
|
PhishER Comments
|
phishercomments |
grid |
PhishER
|
No |
0 |
|
PhishER Created
|
phishercreated |
shortText |
PhishER
|
No |
0 |
|
PhishER Email From
|
phisheremailfrom |
shortText |
PhishER
|
No |
0 |
|
PhishER ID
|
phisherid |
shortText |
PhishER
|
No |
0 |
|
PhishER Links
|
phisherlinks |
markdown |
PhishER
|
No |
0 |
|
PhishER ML Report
|
phishermlreport |
markdown |
PhishER
|
No |
0 |
|
PhishER Pipeline Status
|
phisherpipelinestatus |
shortText |
PhishER
|
No |
0 |
|
PhishER Raw URL
|
phisherrawurl |
longText |
PhishER
|
No |
0 |
|
PhishER Reported By
|
phisherreportedby |
shortText |
PhishER
|
No |
0 |
|
PhishER Severity
|
phisherseverity |
shortText |
PhishER
|
No |
0 |
|
PhishER Subject
|
phishersubject |
shortText |
PhishER
|
No |
0 |
|
PhishER Tags
|
phishertags |
grid |
PhishER
|
No |
0 |
|
Phishing BCL Score
|
phishingbclscore |
number |
Phishing
|
No |
0 |
|
Phishing PCL Score
|
phishingpclscore |
number |
Phishing
|
No |
0 |
|
Phishing Reporter Email Headers
|
phishingreporteremailheaders |
grid |
Phishing
|
No |
0 |
|
Phishing SCL Score
|
phishingsclscore |
number |
Phishing
|
No |
0 |
|
Phishing Sub-type
|
phishingsubtype |
multiSelect |
Phishing
|
No |
0 |
|
Phone Number
|
phonenumber |
multiSelect |
Common Types
|
No |
0 |
|
PingCastle XML Report
|
pingcastlexmlreport |
longText |
PingCastle
|
No |
0 |
|
Playbook Description
|
playbookdescription |
markdown |
Rapid Breach Response
|
No |
0 |
|
Playbook Names With Failed Tasks
|
playbooknameswithfailedtasks |
multiSelect |
Integrations & Incidents Health Check
|
No |
0 |
|
Playbook Tasks Errors
|
playbooktaskserrors |
grid |
Integrations & Incidents Health Check
|
No |
0 |
|
Playbooks Failed Commands
|
playbooksfailedcommands |
multiSelect |
Integrations & Incidents Health Check
|
No |
0 |
|
Playbooks With Failed Tasks
|
playbookswithfailedtasks |
multiSelect |
Integrations & Incidents Health Check
|
No |
0 |
|
Policy Actions
|
policyactions |
multiSelect |
Common Types
|
No |
0 |
|
Policy Deleted
|
policydeleted |
shortText |
Common Types
|
No |
0 |
|
Policy Description
|
policydescription |
longText |
Common Types
|
No |
0 |
|
Policy Details
|
policydetails |
shortText |
Common Types
|
No |
0 |
|
Policy ID
|
policyid |
shortText |
Common Types
|
No |
0 |
|
Policy Optimizer Use-Case
|
policyoptimizerusecase |
multiSelect |
PAN-OS Policy Optimizer (beta)
|
No |
0 |
|
Policy Recommendation
|
policyrecommendation |
longText |
Common Types
|
No |
0 |
|
Policy Remediable
|
policyremediable |
shortText |
Common Types
|
No |
0 |
|
Policy Severity
|
policyseverity |
shortText |
Common Types
|
No |
0 |
|
Policy Type
|
policytype |
shortText |
Common Types
|
No |
0 |
|
Policy URI
|
policyuri |
shortText |
Common Types
|
No |
0 |
|
Ports Blocked
|
portsblocked |
boolean |
Port Scan
|
No |
0 |
|
Possible Cause of the Breach
|
possiblecauseofthebreach |
multiSelect |
Common Scripts
|
No |
0 |
|
Post Nat Destination IP
|
postnatdestinationip |
multiSelect |
Common Types
|
No |
0 |
|
Post Nat Destination Port
|
postnatdestinationport |
multiSelect |
Common Types
|
No |
0 |
|
Post Nat Source IP
|
postnatsourceip |
multiSelect |
Common Types
|
No |
0 |
|
Post Nat Source Port
|
postnatsourceport |
multiSelect |
Common Types
|
No |
0 |
|
Postal Code
|
postalcode |
shortText |
Common Scripts
|
No |
0 |
|
Pre Nat Destination Port
|
prenatdestinationport |
multiSelect |
Common Types
|
No |
0 |
|
Pre Nat Source IP
|
prenatsourceip |
multiSelect |
Common Types
|
No |
0 |
|
Pre Nat Source Port
|
prenatsourceport |
multiSelect |
Common Types
|
No |
0 |
|
Previous Coordinates
|
previouscoordinates |
shortText |
Impossible Traveler
|
No |
0 |
|
Previous Country
|
previouscountry |
shortText |
Impossible Traveler
|
No |
0 |
|
Previous Sign In Date Time
|
previoussignindatetime |
date |
Impossible Traveler
|
No |
0 |
|
Previous Source IP
|
previoussourceip |
shortText |
Impossible Traveler
|
No |
0 |
|
Priority
|
priority |
singleSelect |
FireMon Security Manager
|
No |
0 |
|
Prisma Cloud - Findings Results
|
prismacloudfindingsresults |
grid |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud - IAM Results
|
prismacloudiamresults |
grid |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Activity Type
|
prismacloudcomputeactivitytype |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute AppID
|
prismacloudcomputeappid |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Audit Table
|
prismaaudittable |
markdown |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Category
|
prismacloudcomputecategory |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Cluster
|
prismacloudcomputecluster |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Collections
|
prismacloudcomputecollections |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Command
|
prismacloudcomputecommand |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Container
|
prismacloudcomputecontainer |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Container Compliance Issues
|
prismacloudcomputecontainercomplianceissues |
grid |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Credential ID
|
prismacloudcomputecredentialid |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Defender Logs
|
prismacloudcomputedefenderlogs |
markdown |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Distribution
|
prismacloudcomputedistribution |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Error
|
prismacloudcomputeerror |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute FQDN
|
prismacloudcomputefqdn |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Forensic
|
prismacloudcomputeforensic |
url |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Function
|
prismacloudcomputefunction |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Host
|
prismacloudcomputehost |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Host Compliance Issues
|
prismacloudcomputehostcomplianceissues |
grid |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Image
|
prismacloudcomputeimage |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Image Compliance Issues
|
prismacloudcomputeimagecomplianceissues |
grid |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Interactive
|
prismacloudcomputeinteractive |
boolean |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Kubernetes Resource
|
prismacloudcomputekubernetesresource |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Labels
|
prismacloudcomputelabels |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Line
|
prismacloudcomputeline |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Log File
|
prismacloudcomputelogfile |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Markdown
|
prismacloudcomputemarkdown |
markdown |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Message
|
prismacloudcomputemessage |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Namespaces
|
prismacloudcomputenamespaces |
multiSelect |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute PCC Defender Logs
|
pccdefenderlogs |
markdown |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Project
|
prismacloudcomputeproject |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Protected
|
prismacloudcomputeprotected |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Provider
|
prismacloudcomputeprovider |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Raw Alert JSON
|
prismacloudcomputerawalertjson |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Region
|
prismacloudcomputeregion |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Registry
|
prismacloudcomputeregistry |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Rule
|
prismacloudcomputerule |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Runtime
|
prismacloudcomputeruntime |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Service
|
prismacloudcomputeservice |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Service Type
|
prismacloudcomputeservicetype |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Show Compliance Tab
|
prismacloudcomputeshowcompliancetab |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Tickets Info
|
prismacloudcomputeticketsinfo |
grid |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Total
|
prismacloudcomputetotal |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute Type
|
prismacloudcomputetype |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Compute User
|
prismacloudcomputeuser |
shortText |
Prisma Cloud Compute by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Dismissal Note
|
prismaclouddismissalnote |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud ID
|
prismacloudid |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Reason
|
prismacloudreason |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Rules
|
prismacloudrules |
grid |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Status
|
prismacloudstatus |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Prisma Cloud Time
|
prismacloudtime |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Privilege Escalation Remediation Products
|
privilegeescalationremediationproducts |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Process CMD
|
processcmd |
multiSelect |
Common Types
|
No |
0 |
|
Process Creation Time
|
processcreationtime |
multiSelect |
Common Types
|
No |
0 |
|
Process ID
|
processid |
multiSelect |
Common Types
|
No |
0 |
|
Process MD5
|
processmd5 |
multiSelect |
Common Types
|
No |
0 |
|
Process Name
|
processname |
shortText |
Common Types
|
No |
0 |
|
Process Names
|
processnames |
multiSelect |
Common Types
|
No |
0 |
|
Process Path
|
processpath |
shortText |
Common Types
|
No |
0 |
|
Process Paths
|
processpaths |
multiSelect |
Common Types
|
No |
0 |
|
Process SHA256
|
processsha256 |
multiSelect |
Common Types
|
No |
0 |
|
Process execution signature
|
processexecutionsignature |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Process execution signer
|
processexecutionsigner |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Project ID
|
projectid |
multiSelect |
Common Types
|
No |
0 |
|
Proofpoint TAP Campaign ID
|
proofpointtapcampaignid |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Classification
|
proofpointtapclassification |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Click IP
|
proofpointtapclickip |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Click Time
|
proofpointtapclicktime |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Cluster
|
proofpointtapcluster |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Examined By
|
proofpointtapexaminedby |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP GUID
|
proofpointtapguid |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Header CC
|
proofpointtapheadercc |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Header To
|
proofpointtapheaderto |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Headers From
|
proofpointtapheadersfrom |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Headers Reply To
|
proofpointtapheadersreplyto |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP ID
|
proofpointtapid |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Imposter Score
|
proofpointtapimposterscore |
number |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Long Subject
|
proofpointtaplongsubject |
longText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Malware Score
|
proofpointtapmalwarescore |
number |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Message ID
|
proofpointtapmessageid |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Message Parts
|
proofpointtapmessageparts |
grid |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Message Size
|
proofpointtapmessagesize |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Phishing Score
|
proofpointtapphishingscore |
number |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Policies
|
proofpointtappolicies |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Quarantine Folder
|
proofpointtapquarantinefolder |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Quarantine Rule
|
proofpointtapquarantinerule |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Reply To Address
|
proofpointtapreplytoaddress |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP SMTP Recipient
|
proofpointtapsmtprecipient |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP SMTP Sender
|
proofpointtapsmtpsender |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Sender Address
|
proofpointtapsenderaddress |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Sender IP
|
proofpointtapsenderip |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Spam Score
|
proofpointtapspamscore |
number |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Subject
|
proofpointtapsubject |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Suspicious URL
|
proofpointtapsuspiciousurl |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Threat ID
|
proofpointtapthreatid |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Threat Info Map
|
proofpointtapthreatinfomap |
grid |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Threat Status
|
proofpointtapthreatstatus |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Threat Time
|
proofpointtapthreattime |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Threat URL
|
proofpointtapthreaturl |
url |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Type
|
proofpointtaptype |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP User Agent
|
proofpointtapuseragent |
shortText |
Proofpoint TAP
|
No |
0 |
|
Proofpoint TAP Xmailer
|
proofpointtapxmailer |
shortText |
Proofpoint TAP
|
No |
0 |
|
Protocol
|
protocol |
shortText |
Common Types
|
No |
0 |
|
Protocol - Event
|
protocolevent |
multiSelect |
Common Types
|
No |
0 |
|
Protocol names
|
protocolnames |
multiSelect |
Common Types
|
No |
0 |
|
Protocols
|
protocols |
shortText |
Common Types
|
No |
0 |
|
QSS Case Acknowledged
|
qsscaseacknowledged |
shortText |
Quantum Security Systems
|
No |
0 |
|
QSS Case Assets
|
qsscaseassets |
grid |
Quantum Security Systems
|
No |
0 |
|
QSS Case Assignee
|
qsscaseassignee |
shortText |
Quantum Security Systems
|
No |
0 |
|
QSS Case Category
|
qsscasecategory |
shortText |
Quantum Security Systems
|
No |
0 |
|
QSS Case Created By
|
qsscasecreatedby |
shortText |
Quantum Security Systems
|
No |
0 |
|
QSS Case Creation Date
|
qsscasecreationdate |
date |
Quantum Security Systems
|
No |
0 |
|
QSS Case Description
|
qsscasedescription |
html |
Quantum Security Systems
|
No |
0 |
|
QSS Case False Positive
|
qsscasefalsepositive |
shortText |
Quantum Security Systems
|
No |
0 |
|
QSS Case ID
|
qsscaseid |
number |
Quantum Security Systems
|
No |
0 |
|
QSS Case IOCs
|
qsscaseiocs |
grid |
Quantum Security Systems
|
No |
0 |
|
QSS Case Last Update
|
qsscaselastupdate |
date |
Quantum Security Systems
|
No |
0 |
|
QSS Case Notes
|
qsscasenotes |
html |
Quantum Security Systems
|
No |
0 |
|
QSS Case Number
|
qsscasenumber |
shortText |
Quantum Security Systems
|
No |
0 |
|
QSS Case Severity
|
qsscaseseverity |
shortText |
Quantum Security Systems
|
No |
0 |
|
QSS Case Status
|
qsscasestatus |
shortText |
Quantum Security Systems
|
No |
0 |
|
QSS Case Sub Category
|
qsscasesubcategory |
shortText |
Quantum Security Systems
|
No |
0 |
|
QSS Case TLP
|
qsscasetlp |
shortText |
Quantum Security Systems
|
No |
0 |
|
QSS Case Tags
|
qsscasetags |
tagsSelect |
Quantum Security Systems
|
No |
0 |
|
QSS Case Title
|
qsscasetitle |
shortText |
Quantum Security Systems
|
No |
0 |
|
QSS Custom Attribute
|
qsscustomattribute |
grid |
Quantum Security Systems
|
No |
0 |
|
Qintel QWatch Exposures
|
qintelqwatchexposures |
grid |
Qintel
|
No |
0 |
|
Qualys-Fim Alert ID
|
qualysfimalertid |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Alert Name
|
qualysfimalertname |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Approval Date
|
qualysfimapprovaldate |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Approval Status
|
qualysfimapprovalstatus |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Approval Type
|
qualysfimapprovaltype |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Assigned Date
|
qualysfimassigneddate |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Changed Type
|
qualysfimchangedtype |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Comment
|
qualysfimcomment |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Created By
|
qualysfimcreatedby |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Created Date
|
qualysfimcreateddate |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Event Type
|
qualysfimeventtype |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Last updated by
|
qualysfimlastupdatedby |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Query
|
qualysfimquery |
longText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Reviewers
|
qualysfimreviewers |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Status
|
qualysfimstatus |
shortText |
QualysFIM
|
No |
0 |
|
Qualys-Fim Updated Date
|
qualysfimupdateddate |
shortText |
QualysFIM
|
No |
0 |
|
Quarantined
|
quarantined |
shortText |
Malware Core
|
No |
0 |
|
RDPCacheHunting String Sifter
|
incidentrdpcachehuntingstringsifter |
grid |
RDPCacheHunting
|
No |
0 |
|
RDPCacheHunting Strings Similarity
|
incidentrdpachehuntingstringssimilarity |
grid |
RDPCacheHunting
|
No |
0 |
|
RF AI Insights
|
rfaiinsights |
longText |
Recorded Future
|
No |
0 |
|
RF Affected Products
|
rfaffectedproducts |
shortText |
Recorded Future
|
No |
0 |
|
RF DNS Records
|
rfdnsrecords |
grid |
Recorded Future
|
No |
0 |
|
RF Documents
|
rfdocuments |
grid |
Recorded Future
|
No |
0 |
|
RF Entities
|
rfentities |
grid |
Recorded Future
|
No |
0 |
|
RF Fragment
|
rffragment |
longText |
Recorded Future
|
No |
0 |
|
RF Identified CVE
|
rfidentifiedcve |
grid |
Recorded Future
|
No |
0 |
|
RF Identified Domain
|
rfidentifieddomain |
grid |
Recorded Future
|
No |
0 |
|
RF Insikt Notes
|
rfinsiktnotes |
grid |
Recorded Future
|
No |
0 |
|
RF Lifecycle Stage
|
rflifecyclestage |
shortText |
Recorded Future
|
No |
0 |
|
RF Markdown
|
rfmarkdown |
markdown |
Recorded Future
|
No |
0 |
|
RF Portal URL
|
rfportalurl |
url |
Recorded Future
|
No |
0 |
|
RF Risk Rule
|
rfriskrule |
grid |
Recorded Future
|
No |
0 |
|
RF Rule ID
|
rfruleid |
shortText |
Recorded Future
|
No |
0 |
|
RF Targeted Domains
|
rftargeteddomains |
shortText |
Recorded Future
|
No |
0 |
|
RF Targeted Products
|
rftargetedproducts |
shortText |
Recorded Future
|
No |
0 |
|
RF Triggered By
|
rftriggeredby |
shortText |
Recorded Future
|
No |
0 |
|
RF Whois Record Data
|
rfwhoisrecorddata |
grid |
Recorded Future
|
No |
0 |
|
RRN
|
rrn |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
RSA Alert Count
|
rsaalertcount |
shortText |
NetWitness
|
No |
0 |
|
RSA Alerts
|
rsaalerts |
grid |
NetWitness
|
No |
0 |
|
RSA Event Count
|
rsaeventcount |
shortText |
NetWitness
|
No |
0 |
|
RSA Id
|
rsaid |
shortText |
NetWitness
|
No |
0 |
|
RSA Metas Events
|
rsametasevents |
grid |
NetWitness
|
No |
0 |
|
RSA Raw Logs List
|
rsarawlogslist |
grid |
NetWitness
|
No |
0 |
|
RSA Rule Id
|
rsaruleid |
shortText |
NetWitness
|
No |
0 |
|
Ransomware Approximate Number Of Encrypted Endpoints
|
ransomwareapproximatenumberofencryptedendpoints |
shortText |
Ransomware
|
No |
0 |
|
Ransomware Cryptocurrency Address
|
ransomwarecryptocurrencyaddress |
multiSelect |
Ransomware
|
No |
0 |
|
Ransomware Cryptocurrency Address Type
|
ransomwarecryptocurrencyaddresstype |
multiSelect |
Ransomware
|
No |
0 |
|
Ransomware Data Encryption Status
|
ransomwaredataencryptionstatus |
shortText |
Ransomware
|
No |
0 |
|
Ransomware Email
|
ransomwareemail |
multiSelect |
Ransomware
|
No |
0 |
|
Ransomware Encrypted File Owner
|
ransomwareencryptedfileowner |
shortText |
Ransomware
|
No |
0 |
|
Ransomware Note
|
ransomwarenote |
longText |
Ransomware
|
No |
0 |
|
Ransomware Onion Address
|
ransomwareonionaddress |
multiSelect |
Ransomware
|
No |
0 |
|
Ransomware Recovery Tool
|
ransomwarerecoverytool |
shortText |
Ransomware
|
No |
0 |
|
Ransomware Strain
|
ransomwarestrain |
shortText |
Ransomware
|
No |
0 |
|
Rapid7 ThreatCommand Assets
|
rapid7threatcommandassets |
grid |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Attachments
|
rapid7threatcommandattachments |
grid |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand CSV
|
rapid7threatcommandcsv |
grid |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Related IOCs
|
rapid7threatcommandrelatediocs |
multiSelect |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Related Threat IDs
|
rapid7threatcommandrelatedthreatids |
shortText |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Source Date
|
rapid7threatcommandsourcedate |
date |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Source Email
|
rapid7threatcommandsourceemail |
user |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Source Network Type
|
rapid7threatcommandsourcenetworktype |
shortText |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Source Type
|
rapid7threatcommandsourcetype |
shortText |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Source URL
|
rapid7threatcommandsourceurl |
shortText |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Status
|
rapid7threatcommandstatus |
singleSelect |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Subtype
|
rapid7threatcommandsubtype |
shortText |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Tags
|
rapid7threatcommandtags |
multiSelect |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rapid7 ThreatCommand Takedown Status
|
rapid7threatcommandtakedownstatus |
shortText |
Rapid7 - Threat Command (IntSights)
|
No |
0 |
|
Rating
|
rating |
shortText |
Common Types
|
No |
0 |
|
Raw Event
|
rawevent |
multiSelect |
Common Types
|
No |
0 |
|
Raw Participants
|
rawparticipants |
longText |
ExtraHop Reveal(x)
|
No |
0 |
|
Recorded Future AI Insights
|
recordedfutureaiinsights |
longText |
Recorded Future Intelligence
|
No |
0 |
|
Recorded Future Alert Entities
|
recordedfuturealertentities |
grid |
Recorded Future Intelligence
|
No |
0 |
|
Recorded Future Attack Surface Intelligence Affected Hosts
|
recordedfutureattacksurfaceintelligenceaffectedhosts |
grid |
Recorded Future Attack Surface Intelligence
|
No |
0 |
|
Recorded Future Attack Surface Intelligence Attack Surface Rule
|
recordedfutureattacksurfaceintelligenceattacksurfacerule |
shortText |
Recorded Future Attack Surface Intelligence
|
No |
0 |
|
Recorded Future Attack Surface Intelligence Triggered Rules
|
recordedfutureattacksurfaceintelligencetriggeredrules |
grid |
Recorded Future Attack Surface Intelligence
|
No |
0 |
|
Recorded Future DNS Records
|
recordedfuturednsrecords |
grid |
Recorded Future Intelligence
|
No |
0 |
|
Recorded Future Identified CVE
|
recordedfutureidentifiedcve |
grid |
Recorded Future Intelligence
|
No |
0 |
|
Recorded Future Identified Domain
|
recordedfutureidentifieddomain |
grid |
Recorded Future Intelligence
|
No |
0 |
|
Recorded Future Identity Assessment
|
recordedfutureidentityassessment |
shortText |
Recorded Future Identity
|
No |
0 |
|
Recorded Future Identity Authorization URL
|
recordedfutureidentityauthorizationurl |
shortText |
Recorded Future Identity
|
No |
0 |
|
Recorded Future Identity Compromised Host
|
recordedfutureidentitycompromisedhost |
grid |
Recorded Future Identity
|
No |
0 |
|
Recorded Future Identity Dump Name
|
recordedfutureidentitydumpname |
shortText |
Recorded Future Identity
|
No |
0 |
|
Recorded Future Identity Exposed Hint
|
recordedfutureidentityexposedhint |
shortText |
Recorded Future Identity
|
No |
0 |
|
Recorded Future Identity Exposed Properties
|
recordedfutureidentityexposedproperties |
shortText |
Recorded Future Identity
|
No |
0 |
|
Recorded Future Identity Exposed Secret
|
recordedfutureidentityexposedsecret |
grid |
Recorded Future Identity
|
No |
0 |
|
Recorded Future Identity Exposed Value
|
recordedfutureidentityexposedvalue |
shortText |
Recorded Future Identity
|
No |
0 |
|
Recorded Future Identity Malware Family
|
recordedfutureidentitymalwarefamily |
shortText |
Recorded Future Identity
|
No |
0 |
|
Recorded Future Identity Name
|
recordedfutureidentityname |
shortText |
Recorded Future Identity
|
No |
0 |
|
Recorded Future Insikt Notes
|
recordedfutureinsiktnotes |
grid |
Recorded Future Intelligence
|
No |
0 |
|
Recorded Future Risk Rule
|
recordedfutureriskrule |
grid |
Recorded Future Intelligence
|
No |
0 |
|
Recorded Future Targeted Domains
|
recordedfuturetargeteddomains |
longText |
Recorded Future Intelligence
|
No |
0 |
|
Recorded Future Targeted Products
|
recordedfuturetargetedproducts |
shortText |
Recorded Future Intelligence
|
No |
0 |
|
Recorded Future Whois Record Data
|
recordedfuturewhoisrecorddata |
grid |
Recorded Future Intelligence
|
No |
0 |
|
Referenced Resource ID
|
referencedresourceid |
multiSelect |
Common Types
|
No |
0 |
|
Referenced Resource Name
|
referencedresourcename |
multiSelect |
Common Types
|
No |
0 |
|
Region
|
region |
shortText |
Common Types
|
No |
0 |
|
Region ID
|
regionid |
shortText |
Common Types
|
No |
0 |
|
Registration Email
|
registrationemail |
shortText |
Common Types
|
No |
0 |
|
Registry Data
|
registrydata |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Registry Full Key
|
registryfullkey |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Registry Hive
|
registryhive |
multiSelect |
Common Types
|
No |
0 |
|
Registry Key
|
registrykey |
multiSelect |
Common Types
|
No |
0 |
|
Registry Value
|
registryvalue |
multiSelect |
Common Types
|
No |
0 |
|
Registry Value Type
|
registryvaluetype |
multiSelect |
Common Types
|
No |
0 |
|
Related Alerts
|
relatedalerts |
markdown |
Common Types
|
No |
0 |
|
Related Campaign
|
relatedcampaign |
shortText |
Common Types
|
No |
0 |
|
Related Endpoints
|
relatedendpoints |
shortText |
Common Types
|
No |
0 |
|
Related Report
|
relatedreport |
shortText |
Common Types
|
No |
0 |
|
Relevance - Offense
|
relevanceoffense |
number |
IBM QRadar
|
No |
0 |
|
Remaining Task Count
|
remainingtaskcount |
shortText |
Rapid Breach Response
|
No |
0 |
|
Remediated Techniques
|
remediatedtechniques |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Remediation SLA
|
remediationsla |
timer |
Common Types
|
No |
0 |
|
Remediation Task Count
|
remediationtaskcount |
shortText |
Rapid Breach Response
|
No |
0 |
|
Remote Agent Hostname
|
remoteagenthostname |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Remote Host
|
remotehost |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Remote IP
|
remoteip |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Remote Port
|
remoteport |
multiSelect |
Core Alert Fields
|
No |
0 |
|
RemovedFromCampaigns
|
removedfromcampaigns |
multiSelect |
Common Types
|
No |
0 |
|
Rendered HTML
|
renderedhtml |
html |
Common Types
|
No |
0 |
|
Report Name
|
reportname |
markdown |
Common Types
|
No |
0 |
|
Reported Email CC
|
reportedemailcc |
shortText |
Phishing
|
No |
0 |
|
Reported Email From
|
reportedemailfrom |
shortText |
Phishing
|
No |
0 |
|
Reported Email Message ID
|
reportedemailmessageid |
shortText |
Phishing
|
No |
0 |
|
Reported Email Origin
|
reportedemailorigin |
singleSelect |
Phishing
|
No |
0 |
|
Reported Email Subject
|
reportedemailsubject |
shortText |
Phishing
|
No |
0 |
|
Reported Email To
|
reportedemailto |
shortText |
Phishing
|
No |
0 |
|
Reporter Email Address
|
reporteremailaddress |
shortText |
Common Types
|
No |
0 |
|
Requirements
|
requirements |
grid |
FireMon Security Manager
|
No |
0 |
|
Resident Notification Option
|
residentnotificationoption |
shortText |
Common Scripts
|
No |
0 |
|
Residents Email Address
|
residentsemailaddress |
grid |
Common Scripts
|
No |
0 |
|
Resolved
|
resolved |
boolean |
Nutanix Hypervisor
|
No |
0 |
|
Resource API Name
|
resourceapiname |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Resource Cloud Type
|
resourcecloudtype |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Resource ID
|
resourceid |
shortText |
Common Types
|
No |
0 |
|
Resource Name
|
resourcename |
shortText |
Common Types
|
No |
0 |
|
Resource Type
|
resourcetype |
shortText |
Common Types
|
No |
0 |
|
Resource URL
|
resourceurl |
shortText |
Common Types
|
No |
0 |
|
Risk Name
|
riskname |
shortText |
Common Types
|
No |
0 |
|
Risk Rating
|
riskrating |
shortText |
Common Types
|
No |
0 |
|
Risk Score
|
riskscore |
shortText |
Common Types
|
No |
0 |
|
RiskIQ Asset AWS Security Group Name
|
riskiqassetawssecuritygroupname |
shortText |
RiskIQ Digital Footprint
|
No |
0 |
|
RiskIQ Asset Contact
|
riskiqassetcontact |
shortText |
RiskIQ Digital Footprint
|
No |
0 |
|
RiskIQ Asset GCP Firewall Name
|
riskiqassetgcpfirewallname |
shortText |
RiskIQ Digital Footprint
|
No |
0 |
|
RiskIQ Asset Name
|
riskiqassetname |
shortText |
RiskIQ Digital Footprint
|
No |
0 |
|
RiskIQ Asset Okta Zone ID
|
riskiqassetoktazoneid |
shortText |
RiskIQ Digital Footprint
|
No |
0 |
|
RiskIQ Asset Owner
|
riskiqassetowner |
shortText |
RiskIQ Digital Footprint
|
No |
0 |
|
RiskIQ Asset Type
|
riskiqassettype |
singleSelect |
RiskIQ Digital Footprint
|
No |
0 |
|
RiskIQ Auto Exclude Whitelisted IP Address
|
riskiqautoexcludewhitelistedipaddress |
singleSelect |
RiskIQ Digital Footprint
|
No |
0 |
|
RiskIQ Auto Whitelist IP Address
|
riskiqautowhitelistipaddress |
singleSelect |
RiskIQ Digital Footprint
|
No |
0 |
|
RiskIQ Skip Manual Tasks
|
riskiqskipmanualtasks |
boolean |
RiskIQ Digital Footprint
|
No |
0 |
|
RiskIQ Support Contact
|
riskiqsupportcontact |
shortText |
RiskIQ Digital Footprint
|
No |
0 |
|
Rubrik Actor ID
|
rubrikactorid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Actor Name
|
rubrikactorname |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Actor Privilege Type
|
rubrikactorprivilegetype |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Actor State
|
rubrikactorstate |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Actor Type
|
rubrikactortype |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik CDM Cluster ID
|
rubrikcdmclusterid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik CDM Cluster Location
|
rubrikcdmclusterlocation |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik CDM Cluster Name
|
rubrikcdmclustername |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Data Categories
|
rubrikdatacategories |
grid |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Data Types
|
rubrikdatatypes |
grid |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Detection Time
|
rubrikdetectiontime |
date |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Domain ID
|
rubrikdomainid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Domain Name
|
rubrikdomainname |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Entity ID
|
rubrikentityid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Entity Name
|
rubrikentityname |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Event Time
|
rubrikeventtime |
date |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik File Match Count
|
rubrikfilematchcount |
number |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Files At Risk
|
rubrikfilesatrisk |
grid |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik High Risk Hits
|
rubrikhighriskhits |
number |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik IR Violation Status
|
rubrikirviolationstatus |
singleSelect |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Identity Provider
|
rubrikidentityprovider |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Identity Tags
|
rubrikidentitytags |
multiSelect |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Last Detected
|
rubriklastdetected |
date |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Low Risk Hits
|
rubriklowriskhits |
number |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Manual Remediation Process
|
rubrikmanualremediationprocess |
longText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Match Types
|
rubrikmatchtypes |
multiSelect |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Medium Risk Hits
|
rubrikmediumriskhits |
number |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Mitre Tactic
|
rubrikmitretactic |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Native Type
|
rubriknativetype |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik No Risk Hits
|
rubriknoriskhits |
number |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Object Account Name
|
rubrikobjectaccountname |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Object Create Time
|
rubrikobjectcreatetime |
date |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Object Location
|
rubrikobjectlocation |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Object Platform
|
rubrikobjectplatform |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Object Region
|
rubrikobjectregion |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Activity Series ID
|
rubrikpolarisactivityseriesid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Activity Type
|
rubrikpolarisactivitytype |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Analysis Pipeline
|
rubrikpolarisanalysispipeline |
grid |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Analysis Progress
Hidden
|
rubrikpolarisanalysisprogress |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris CDM Cluster ID
Hidden
|
rubrikpolariscdmclusterid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris CDM Cluster Name
Hidden
|
rubrikpolariscdmclustername |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Cluster Location Path
|
rubrikpolarisclusterlocationpath |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Event Completed
|
rubrikpolariseventcompleted |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Event ID
|
rubrikpolariseventid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris FID
|
rubrikpolarisfid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Last Activity Status
|
rubrikpolarislastactivitystatus |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Last Updated
Hidden
|
rubrikpolarislastupdated |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Message
Hidden
|
rubrikpolarismessage |
grid |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Object ID
|
rubrikpolarisobjectid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Object Name
|
rubrikpolarisobjectname |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Object Type
|
rubrikpolarisobjecttype |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Polaris Start Time
|
rubrikpolarisstarttime |
date |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Policy Category
|
rubrikpolicycategory |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Policy Frameworks
|
rubrikpolicyframeworks |
multiSelect |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Policy Name
|
rubrikpolicyname |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Principal Type
|
rubrikprincipaltype |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Privilege Type
|
rubrikprivilegetype |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Resource Source
|
rubrikresourcesource |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Resource Status
|
rubrikresourcestatus |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Resource Unique ID
|
rubrikresourceuniqueid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Root Domain ID
|
rubrikrootdomainid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Root Domain Name
|
rubrikrootdomainname |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Snapshot ID
|
rubriksnapshotid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Suspicious File Count
|
rubriksuspiciousfilecount |
number |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Suspicious File List
|
rubriksuspiciousfilelist |
grid |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Target ID
|
rubriktargetid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Target Identity Provider
|
rubriktargetidentityprovider |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Target Name
|
rubriktargetname |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Target Privilege Type
|
rubriktargetprivilegetype |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Target Source
|
rubriktargetsource |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Target Status
|
rubriktargetstatus |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Target Type
|
rubriktargettype |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Total Risk Hits
|
rubriktotalriskhits |
number |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik User Principal Name
|
rubrikuserprincipalname |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Violation ID
|
rubrikviolationid |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Violation Name
|
rubrikviolationname |
shortText |
Rubrik Security Cloud
|
No |
0 |
|
Rubrik Violation Status
|
rubrikviolationstatus |
singleSelect |
Rubrik Security Cloud
|
No |
0 |
|
Rule ID
|
ruleid |
shortText |
Core Alert Fields
|
No |
0 |
|
Rule Name
|
rulename |
shortText |
Common Types
|
No |
0 |
|
Run with 'insecure'
|
runwithinsecure |
boolean |
Troubleshoot
|
No |
0 |
|
SANS Stage
|
sansstage |
shortText |
SANS
|
No |
0 |
|
SDLP Action Status ID
|
sdlpactionstatusid |
shortText |
Symantec Data Loss Prevention
|
No |
0 |
|
SDLP Detection Server Name
|
sdlpdetectionservername |
shortText |
Symantec Data Loss Prevention
|
No |
0 |
|
SDLP Group Name
|
sdlpgroupname |
shortText |
Symantec Data Loss Prevention
|
No |
0 |
|
SDLP Incident Type
|
sdlpincidenttype |
shortText |
Symantec Data Loss Prevention
|
No |
0 |
|
SDLP Message Type
|
sdlpmessagetype |
shortText |
Symantec Data Loss Prevention
|
No |
0 |
|
SDLP Policy Version
|
sdlppolicyversion |
shortText |
Symantec Data Loss Prevention
|
No |
0 |
|
SDLP Policy Violations Count
|
sdlppolicyviolationscount |
shortText |
Symantec Data Loss Prevention
|
No |
0 |
|
SDLP Recipient URL
|
sdlprecipienturl |
shortText |
Symantec Data Loss Prevention
|
No |
0 |
|
SDLP Scan Start
|
sdlpscanstart |
shortText |
Symantec Data Loss Prevention
|
No |
0 |
|
SDLP Scanned Machine
|
sdlpscannedmachine |
shortText |
Symantec Data Loss Prevention
|
No |
0 |
|
SDLP Target
|
sdlptarget |
shortText |
Symantec Data Loss Prevention
|
No |
0 |
|
SDO Feed
|
sdofeed |
markdown |
Proactive Threat Hunting
|
No |
0 |
|
SDO Name
|
sdoname |
markdown |
Proactive Threat Hunting
|
No |
0 |
|
SHA1
|
sha1 |
shortText |
Common Types
|
No |
0 |
|
SHA256
|
sha256 |
shortText |
Common Types
|
No |
0 |
|
SHA512
|
sha512 |
shortText |
Common Types
|
No |
0 |
|
SKU Name
|
skuname |
shortText |
Common Types
|
No |
0 |
|
SKU TIER
|
skutier |
shortText |
Common Types
|
No |
0 |
|
SOCRadar Company ID
|
socradarcompanyid |
shortText |
SOCRadar
|
No |
0 |
|
SOCRadar Detection And Analysis
|
socradardetectionandanalysis |
html |
SOCRadar
|
No |
0 |
|
SOCRadar Incident Assets
|
socradarincidentassets |
shortText |
SOCRadar
|
No |
0 |
|
SOCRadar Incident Content
|
socradarincidentcontent |
html |
SOCRadar
|
No |
0 |
|
SOCRadar Incident ID
|
socradarincidentid |
shortText |
SOCRadar
|
No |
0 |
|
SOCRadar Incident Link
|
socradarincidentlink |
url |
SOCRadar
|
No |
0 |
|
SOCRadar Incident Main Type
|
socradarincidentmaintype |
shortText |
SOCRadar
|
No |
0 |
|
SOCRadar Incident Sub Type
|
socradarincidentsubtype |
shortText |
SOCRadar
|
No |
0 |
|
SOCRadar Mitigation
|
socradarmitigation |
shortText |
SOCRadar
|
No |
0 |
|
SOCRadar Post Incident Analysis
|
socradarpostincidentanalysis |
html |
SOCRadar
|
No |
0 |
|
SOCRadar Related Assets
|
socradarrelatedassets |
shortText |
SOCRadar
|
No |
0 |
|
SOCRadar Related Entities
|
socradarrelatedentities |
shortText |
SOCRadar
|
No |
0 |
|
SOCRadar Response
|
socradarresponse |
html |
SOCRadar
|
No |
0 |
|
SSDeep
|
ssdeep |
shortText |
Common Types
|
No |
0 |
|
SSL Certificates (Expired)
|
sslcertificatesexpired |
grid |
SSL Certificates
|
No |
0 |
|
SSL Certificates (Expiring)
|
sslcertificatesexpiring |
grid |
SSL Certificates
|
No |
0 |
|
SSL Certificates (Good)
|
sslcertificatesgood |
grid |
SSL Certificates
|
No |
0 |
|
SSL Certificates (Warning)
|
sslcertificateswarning |
grid |
SSL Certificates
|
No |
0 |
|
Saas Security Asset ID
|
saassecurityassetid |
shortText |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Asset Name
|
saassecurityassetname |
shortText |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Asset Owner
|
saassecurityassetowner |
shortText |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Asset Owner Email
|
saassecurityassetowneremail |
shortText |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Asset URL
|
saassecurityasseturl |
shortText |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Assigned To
|
saassecurityassignedto |
shortText |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Category
|
saassecuritycategory |
singleSelect |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Incident Id
|
saassecurityincidentid |
number |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Incident Severity Level
|
saassecurityincidentseveritylevel |
shortText |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Remediation Type
|
saassecurityremediationtype |
singleSelect |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Remove Inherited Sharing
|
saassecurityremoveinheritedsharing |
boolean |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Resolved By
|
saassecurityresolvedby |
shortText |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security State
|
saassecuritystate |
singleSelect |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
Saas Security Status
|
saassecuritystatus |
singleSelect |
SaaS Security by Palo Alto Networks
|
No |
0 |
|
SafeBreach Affected Targets
|
safebreachaffectedtargets |
grid |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Affected Targets Count
|
safebreachaffectedtargetscount |
number |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Attack Count
|
safebreachattackcount |
number |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Attack Ids
|
safebreachattackids |
tagsSelect |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Insight Category
|
safebreachinsightcategory |
shortText |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Insight Id
|
safebreachinsightid |
number |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Insight Name
|
safebreachinsightname |
shortText |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Insight Risk Impact
|
safebreachinsightriskimpact |
number |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Latest Simulation
|
safebreachlatestsimulation |
date |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Remediation Action
|
safebreachremediationaction |
shortText |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Remediation Data
|
safebreachremediationdata |
grid |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Remediation Data Count
|
safebreachremediationdatacount |
number |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Remediation Status
|
safebreachremediationstatus |
singleSelect |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Results Link
|
safebreachresultslink |
url |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Severity
|
safebreachseverity |
singleSelect |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Severity Score
|
safebreachseverityscore |
number |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Simulation Id
|
safebreachsimulationid |
shortText |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Simulation Number
|
safebreachsimulationnumber |
number |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeBreach Threat Groups
|
safebreachthreatgroups |
tagsSelect |
SafeBreach - Breach and Attack Simulation platform
|
No |
0 |
|
SafeNet Trusted Access - Instance Name
|
safenettrustedaccessinstancename |
shortText |
Thales SafeNet Trusted Access
|
No |
0 |
|
SafeNet Trusted Access - Remove User from Unusual Activity Group
|
safenettrustedaccessremoveuserfromunusualactivitygroup |
singleSelect |
Thales SafeNet Trusted Access
|
No |
0 |
|
SafeNet Trusted Access - Unusual Activity Group
|
safenettrustedaccessunusualactivitygroup |
shortText |
Thales SafeNet Trusted Access
|
No |
0 |
|
SafeNet Trusted Access - User in Unusual Activity Group (Hours)
|
safenettrustedaccessuserinunusualactivitygrouphours |
shortText |
Thales SafeNet Trusted Access
|
No |
0 |
|
SafeNet Trusted Access - Username
|
safenettrustedaccessusername |
shortText |
Thales SafeNet Trusted Access
|
No |
0 |
|
SailPoint IdentityIQ Alert Display Name
|
sailpointidentityiqalertdisplayname |
shortText |
SailPoint IdentityIQ
|
No |
0 |
|
SailPoint IdentityIQ Alert Target Display Name
|
sailpointidentityiqalerttargetdisplayname |
shortText |
SailPoint IdentityIQ
|
No |
0 |
|
SailPoint IdentityIQ Alert Target Id
|
sailpointidentityiqalerttargetid |
shortText |
SailPoint IdentityIQ
|
No |
0 |
|
SailPoint IdentityIQ Alert Target Type
|
sailpointidentityiqalerttargettype |
shortText |
SailPoint IdentityIQ
|
No |
0 |
|
SailPoint IdentityIQ Alert Type
|
sailpointidentityiqalerttype |
shortText |
SailPoint IdentityIQ
|
No |
0 |
|
SailPoint IdentityNow Trigger Access Request Details
|
sailpointidentitynowtriggeraccessrequestdetails |
shortText |
SailPoint IdentityNow
|
No |
0 |
|
SailPoint IdentityNow Trigger Account Aggregated Details
|
sailpointidentitynowtriggeraccountaggregateddetails |
shortText |
SailPoint IdentityNow
|
No |
0 |
|
SailPoint IdentityNow Trigger Attributes
|
sailpointidentitynowtriggerattributes |
shortText |
SailPoint IdentityNow
|
No |
0 |
|
SailPoint IdentityNow Trigger Changes
|
sailpointidentitynowtriggerchanges |
shortText |
SailPoint IdentityNow
|
No |
0 |
|
SailPoint IdentityNow Trigger Identity
|
sailpointidentitynowtriggeridentity |
shortText |
SailPoint IdentityNow
|
No |
0 |
|
SailPoint IdentityNow Trigger Metadata
|
sailpointidentitynowtriggermetadata |
shortText |
SailPoint IdentityNow
|
No |
0 |
|
SailPoint IdentityNow Trigger Post Provisioning Details
|
sailpointidentitynowtriggerpostprovisioningdetails |
shortText |
SailPoint IdentityNow
|
No |
0 |
|
SailPoint IdentityNow Trigger Search Completed Details
|
sailpointidentitynowtriggersearchcompleteddetails |
shortText |
SailPoint IdentityNow
|
No |
0 |
|
SalesforceV2 Case Number
|
salesforcecasenumber |
shortText |
SalesforceV2
|
No |
0 |
|
SalesforceV2 Closed Date
|
salesforcecloseddate |
date |
SalesforceV2
|
No |
0 |
|
SalesforceV2 Escalated
|
salesforceescalated |
boolean |
SalesforceV2
|
No |
0 |
|
SalesforceV2 Last Modified Date
|
salesforcelastmodifieddate |
date |
SalesforceV2
|
No |
0 |
|
SalesforceV2 Milestone Status
|
salesforcemilestonestatus |
shortText |
SalesforceV2
|
No |
0 |
|
SalesforceV2 Origin
|
salesforceorigin |
shortText |
SalesforceV2
|
No |
0 |
|
SalesforceV2 Owner
|
salesforceowner |
shortText |
SalesforceV2
|
No |
0 |
|
SalesforceV2 Priority
|
salesforcepriority |
shortText |
SalesforceV2
|
No |
0 |
|
SalesforceV2 Status
|
salesforcestatus |
singleSelect |
SalesforceV2
|
No |
0 |
|
SalesforceV2 Subject
|
salesforcesubject |
shortText |
SalesforceV2
|
No |
0 |
|
Scan Source Type
|
scansourcetype |
singleSelect |
Port Scan
|
No |
0 |
|
Scenario
|
scenario |
multiSelect |
Common Types
|
No |
0 |
|
Secretary Notification
|
secretarynotification |
singleSelect |
Common Scripts
|
No |
0 |
|
Sector of Affected Party
|
sectorofaffectedparty |
shortText |
Common Scripts
|
No |
0 |
|
Security Policy Match
|
securitypolicymatch |
grid |
Change Management
|
No |
0 |
|
SecurityScorecard Company Name
|
securityscorecardcompanyname |
shortText |
SecurityScorecard
|
No |
0 |
|
SecurityScorecard Domain
|
securityscorecarddomain |
url |
SecurityScorecard
|
No |
0 |
|
SecurityScorecard Factor
|
securityscorecardfactor |
shortText |
SecurityScorecard
|
No |
0 |
|
SecurityScorecard Grade
|
securityscorecardgrade |
shortText |
SecurityScorecard
|
No |
0 |
|
SecurityScorecard Score
|
securityscorecardscore |
number |
SecurityScorecard
|
No |
0 |
|
SecurityScorecard Score Impact
|
securityscorecardscoreimpact |
number |
SecurityScorecard
|
No |
0 |
|
SecurityScorecard Username
|
securityscorecardusername |
shortText |
SecurityScorecard
|
No |
0 |
|
Securonix Bulk Action Allowed
|
securonixbulkactionallowed |
boolean |
Securonix
|
No |
0 |
|
Securonix Case Create Time
|
securonixcasecreatetime |
date |
Securonix
|
No |
0 |
|
Securonix Case Event End Time
|
securonixcaseeventendtime |
date |
Securonix
|
No |
0 |
|
Securonix Category
|
securonixcategory |
shortText |
Securonix
|
No |
0 |
|
Securonix Close Incident
|
securonixcloseincident |
boolean |
Securonix
|
No |
0 |
|
Securonix Entity
|
securonixentity |
shortText |
Securonix
|
No |
0 |
|
Securonix Entity ID
|
securonixentityid |
shortText |
Securonix
|
No |
0 |
|
Securonix Incident ID
|
securonixincidentid |
shortText |
Securonix
|
No |
0 |
|
Securonix Incident Status
|
securonixincidentstatus |
shortText |
Securonix
|
No |
0 |
|
Securonix Incident Type
|
securonixincidenttype |
shortText |
Securonix
|
No |
0 |
|
Securonix Is Whitelisted
|
securonixiswhitelisted |
boolean |
Securonix
|
No |
0 |
|
Securonix Last Update Date
|
securonixlastupdatedate |
date |
Securonix
|
No |
0 |
|
Securonix Parent Case ID
|
securonixparentcaseid |
shortText |
Securonix
|
No |
0 |
|
Securonix Policies
|
securonixpolicies |
multiSelect |
Securonix
|
No |
0 |
|
Securonix Policy Stages
|
securonixpolicystages |
markdown |
Securonix
|
No |
0 |
|
Securonix Policy Type
|
securonixpolicytype |
shortText |
Securonix
|
No |
0 |
|
Securonix Reason
|
securonixreason |
multiSelect |
Securonix
|
No |
0 |
|
Securonix Resource Name
|
securonixresourcename |
shortText |
Securonix
|
No |
0 |
|
Securonix Resource Type
|
securonixresourcetype |
shortText |
Securonix
|
No |
0 |
|
Securonix ResourceGroup Name
|
securonixresourcegroupname |
shortText |
Securonix
|
No |
0 |
|
Securonix Risk Score
|
securonixriskscore |
number |
Securonix
|
No |
0 |
|
Securonix Sandbox Policy
|
securonixsandboxpolicy |
boolean |
Securonix
|
No |
0 |
|
Securonix Status Completed
|
securonixstatuscompleted |
boolean |
Securonix
|
No |
0 |
|
Securonix Tenant Color
|
securonixtenantcolor |
shortText |
Securonix
|
No |
0 |
|
Securonix Tenant ID
|
securonixtenantid |
number |
Securonix
|
No |
0 |
|
Securonix Tenant Short Code
|
securonixtenantshortcode |
shortText |
Securonix
|
No |
0 |
|
Securonix Threat Generation Time
|
securonixthreatgenerationtime |
date |
Securonix
|
No |
0 |
|
Securonix Violation Count
|
securonixviolationcount |
number |
Securonix
|
No |
0 |
|
Securonix Violation Spotter Query
|
securonixviolationspotterquery |
shortText |
Securonix
|
No |
0 |
|
Securonix Violator
|
securonixviolator |
shortText |
Securonix
|
No |
0 |
|
Securonix Violator ID
|
securonixviolatorid |
shortText |
Securonix
|
No |
0 |
|
Securonix Violator Sub Text
|
securonixviolatorsubtext |
shortText |
Securonix
|
No |
0 |
|
Securonix Violator Text
|
securonixviolatortext |
shortText |
Securonix
|
No |
0 |
|
Securonix Watchlisted
|
securonixwatchlisted |
boolean |
Securonix
|
No |
0 |
|
Securonix Workflow Name
|
securonixworkflowname |
shortText |
Securonix
|
No |
0 |
|
SekoiaXDR Alert Details
|
sekoiaxdralertdetails |
markdown |
SekoiaXDR
|
No |
0 |
|
SekoiaXDR Alert Reject
|
sekoiaxdralertreject |
boolean |
SekoiaXDR
|
No |
0 |
|
SekoiaXDR Alert Status
|
sekoiaxdralertstatus |
shortText |
SekoiaXDR
|
No |
0 |
|
SekoiaXDR Events
|
sekoiaxdrevents |
grid |
SekoiaXDR
|
No |
0 |
|
SekoiaXDR First Seen
|
sekoiaxdrfirstseen |
shortText |
SekoiaXDR
|
No |
0 |
|
SekoiaXDR Kill Chain
|
sekoiaxdrkillchain |
grid |
SekoiaXDR
|
No |
0 |
|
SekoiaXDR MirrorOut
|
sekoiaxdrmirrorout |
boolean |
SekoiaXDR
|
No |
0 |
|
Select Action
|
selectaction |
singleSelect |
Phishing Campaign
|
No |
0 |
|
Select Campaign Incidents
|
selectcampaignincidents |
multiSelect |
Phishing Campaign
|
No |
0 |
|
Select Low Similarity Incidents
|
selectlowsimilarityincidents |
multiSelect |
Phishing Campaign
|
No |
0 |
|
Selected Indicators
|
selectedindicators |
multiSelect |
Common Types
|
No |
0 |
|
Send Body as Raw Text (No Markdown)
|
sendbodyasrawnomarkdown |
boolean |
Email Communication
|
No |
0 |
|
Sensor IP
|
sensorip |
shortText |
Common Types
|
No |
0 |
|
Sensor Name
|
sensorname |
shortText |
Common Types
|
No |
0 |
|
SentinelOne Account ID
|
sentineloneaccountid |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Account Name
|
sentineloneaccountname |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Agent Network Status
|
sentineloneagentnetworkstatus |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Classification Source
|
sentineloneclassificationsource |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider
|
sentinelonecloudprovider |
singleSelect |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider Account
|
sentinelonecloudprovideraccount |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider Image
|
sentinelonecloudproviderimage |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider Instance ID
|
sentinelonecloudproviderinstanceid |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider Instance Size
|
sentinelonecloudproviderinstancesize |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider Location
|
sentinelonecloudproviderlocation |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider Network
|
sentinelonecloudprovidernetwork |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider Resource Group
|
sentinelonecloudproviderresourcegroup |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider Role
|
sentinelonecloudproviderrole |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider Security Group
|
sentinelonecloudprovidersecuritygroup |
multiSelect |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider Service Account
|
sentinelonecloudproviderserviceaccount |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider SubnetId
|
sentinelonecloudprovidersubnetid |
multiSelect |
SentinelOne
|
No |
0 |
|
SentinelOne Cloud Provider Tags
|
sentinelonecloudprovidertags |
multiSelect |
SentinelOne
|
No |
0 |
|
SentinelOne Group ID
|
sentinelonegroupid |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Group Name
|
sentinelonegroupname |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Kubernetes Cluster
|
sentinelonekubernetescluster |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Kubernetes Controller Kind
|
sentinelonekubernetescontrollerkind |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Kubernetes Controller Labels
|
sentinelonekubernetescontrollerlabels |
multiSelect |
SentinelOne
|
No |
0 |
|
SentinelOne Kubernetes Controller Name
|
sentinelonekubernetescontrollername |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Kubernetes Namespace
|
sentinelonekubernetesnamespace |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Kubernetes Namespace Labels
|
sentinelonekubernetesnamespacelabels |
multiSelect |
SentinelOne
|
No |
0 |
|
SentinelOne Kubernetes Node
|
sentinelonekubernetesnode |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Kubernetes Node Labels
|
sentinelonekubernetesnodelabels |
multiSelect |
SentinelOne
|
No |
0 |
|
SentinelOne Kubernetes Pod
|
sentinelonekubernetespod |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Kubernetes Pod Labels
|
sentinelonekubernetespodlabels |
multiSelect |
SentinelOne
|
No |
0 |
|
SentinelOne Kubernetes isContainerQuarantine
|
sentinelonekubernetesiscontainerquarantine |
boolean |
SentinelOne
|
No |
0 |
|
SentinelOne Network Interface Details
|
sentinelonenetworkinterfacedetails |
grid |
SentinelOne
|
No |
0 |
|
SentinelOne Site ID
|
sentinelonesiteid |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Site Name
|
sentinelonesitename |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Threat Analyst Verdict
|
sentinelonethreatanalystverdict |
singleSelect |
SentinelOne
|
No |
0 |
|
SentinelOne Threat ID
|
sentinelonethreatid |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne Threat Status
|
sentinelonethreatstatus |
singleSelect |
SentinelOne
|
No |
0 |
|
SentinelOne Threat Story Line
|
sentinelonethreatstoryline |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne UAM Alert Analyst Verdict
Hidden
|
sentineloneuamalertanalystverdict |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne UAM Alert Analyst Verdict Mapped
|
sentineloneuamalertanalystverdictmapped |
singleSelect |
SentinelOne
|
No |
0 |
|
SentinelOne UAM Alert Attack Surfaces
|
sentineloneuamalertattacksurfaces |
multiSelect |
SentinelOne
|
No |
0 |
|
SentinelOne UAM Alert Detection Product
|
sentineloneuamalertdetectionproduct |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne UAM Alert External Id
|
sentineloneuamalertexternalid |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne UAM Alert ID
|
sentineloneuamalertid |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne UAM Alert Name
|
sentineloneuamalertname |
shortText |
SentinelOne
|
No |
0 |
|
SentinelOne UAM Alert Status
|
sentineloneuamalertstatus |
singleSelect |
SentinelOne
|
No |
0 |
|
Service
|
service |
shortText |
FireMon Security Manager
|
No |
0 |
|
ServiceNow Assigned To
|
servicenowassignedto |
shortText |
ServiceNow
|
No |
0 |
|
ServiceNow Assignment Group
|
servicenowassignmentgroup |
shortText |
ServiceNow
|
No |
0 |
|
ServiceNow Attack Vector
|
servicenowattackvector |
shortText |
ServiceNow
|
No |
0 |
|
ServiceNow Business Impact
|
servicenowbusinessimpact |
singleSelect |
ServiceNow
|
No |
0 |
|
ServiceNow Caller
|
servicenowcaller |
shortText |
ServiceNow
|
No |
0 |
|
ServiceNow Caller ID
|
servicenowcallerid |
shortText |
ServiceNow
|
No |
0 |
|
ServiceNow Category
|
servicenowcategory |
singleSelect |
ServiceNow
|
No |
0 |
|
ServiceNow Closed By
|
servicenowclosedby |
shortText |
ServiceNow
|
No |
0 |
|
ServiceNow Closed Date
|
servicenowcloseddate |
date |
ServiceNow
|
No |
0 |
|
ServiceNow Description
|
servicenowdescription |
longText |
ServiceNow
|
No |
0 |
|
ServiceNow Due Date
|
servicenowduedate |
date |
ServiceNow
|
No |
0 |
|
ServiceNow Escalation
|
servicenowescalation |
shortText |
ServiceNow
|
No |
0 |
|
ServiceNow Impact
|
servicenowimpact |
singleSelect |
ServiceNow
|
No |
0 |
|
ServiceNow Notify
|
servicenownotify |
singleSelect |
ServiceNow
|
No |
0 |
|
ServiceNow Opened Date
|
servicenowopeneddate |
date |
ServiceNow
|
No |
0 |
|
ServiceNow Priority
|
servicenowpriority |
singleSelect |
ServiceNow
|
No |
0 |
|
ServiceNow Record ID
|
servicenowrecordid |
shortText |
IoT by Palo Alto Networks
|
No |
0 |
|
ServiceNow Resolution Code
|
servicenowresolutioncode |
shortText |
ServiceNow
|
No |
0 |
|
ServiceNow Resolution Notes
|
servicenowresolutionnotes |
shortText |
ServiceNow
|
No |
0 |
|
ServiceNow Resolved Time
|
servicenowresolvedtime |
date |
ServiceNow
|
No |
0 |
|
ServiceNow SIR Category
|
servicenowsircategory |
singleSelect |
ServiceNow
|
No |
0 |
|
ServiceNow SIR State
|
servicenowsirstate |
singleSelect |
ServiceNow
|
No |
0 |
|
ServiceNow Severity
|
servicenowseverity |
singleSelect |
ServiceNow
|
No |
0 |
|
ServiceNow State
|
servicenowstate |
singleSelect |
ServiceNow
|
No |
0 |
|
ServiceNow Table Name
|
servicenowtablename |
shortText |
IoT by Palo Alto Networks
|
No |
0 |
|
ServiceNow Ticket ID
|
servicenowticketid |
shortText |
ServiceNow
|
No |
0 |
|
ServiceNow Ticket Number
|
servicenowticketnumber |
shortText |
ServiceNow
|
No |
0 |
|
ServiceNow Urgency
|
servicenowurgency |
singleSelect |
ServiceNow
|
No |
0 |
|
Severity - Offense
|
severityoffense |
number |
IBM QRadar
|
No |
0 |
|
Shadow IT Account Owner Email
|
shadowitaccountowneremail |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT Account Owner Name
|
shadowitaccountownername |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT Billed To Corp
|
shadowitbilledtocorp |
boolean |
Shadow IT
|
No |
0 |
|
Shadow IT Certificate
|
shadowitcertificate |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT Cloud Account ID
|
shadowitcloudaccountid |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT Cloud Account Type
|
shadowitcloudaccounttype |
singleSelect |
Shadow IT
|
No |
0 |
|
Shadow IT FQDN
|
shadowitfqdn |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT IP
|
shadowitip |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT OU Contact Email
|
shadowitoucontactemail |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT OU Contact Name
|
shadowitoucontactname |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT Organizational Unit
|
shadowitorganizationalunit |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT Port
|
shadowitport |
number |
Shadow IT
|
No |
0 |
|
Shadow IT Provider
|
shadowitprovider |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT Region
|
shadowitregion |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT Risk
|
shadowitrisk |
singleSelect |
Shadow IT
|
No |
0 |
|
Shadow IT Sactioned Service
|
shadowitsactionedservice |
boolean |
Shadow IT
|
No |
0 |
|
Shadow IT Sensitive Data
|
shadowitsensitivedata |
boolean |
Shadow IT
|
No |
0 |
|
Shadow IT Service
|
shadowitservice |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT Service Purpose
|
shadowitservicepurpose |
multiSelect |
Shadow IT
|
No |
0 |
|
Shadow IT Source
|
shadowitsource |
shortText |
Shadow IT
|
No |
0 |
|
Shadow IT User Suggestions
|
shadowitusersuggestions |
grid |
Shadow IT
|
No |
0 |
|
Shift manager briefing
|
shiftmanagerbriefing |
longText |
Shift Management
|
No |
0 |
|
Shift open incidents
|
shiftopenincidents |
grid |
Shift Management
|
No |
0 |
|
Sign In Date Time
|
signindatetime |
date |
Impossible Traveler
|
No |
0 |
|
Signature
|
signature |
shortText |
Common Types
|
No |
0 |
|
Similar File Hashes Based on SSDeep
|
similarfilehashesbasedonssdeep |
grid |
Uncover Unknown Malware Using SSDeep
|
No |
0 |
|
Similar incidents Dbot
|
similarincidentsdbot |
grid |
Common Types
|
No |
0 |
|
Simple Debugger Cmd
|
simpledebuggercmd |
shortText |
Simple Debugger
|
No |
0 |
|
Simple Debugger Code
|
simpledebuggercode |
markdown |
Simple Debugger
|
No |
0 |
|
Simple Debugger Data
|
simpledebuggerdata |
markdown |
Simple Debugger
|
No |
0 |
|
Simple Debugger Input
|
simpledebuggerinput |
longText |
Simple Debugger
|
No |
0 |
|
Simple Debugger Output
|
simpledebuggeroutput |
markdown |
Simple Debugger
|
No |
0 |
|
Site
|
cybersixgillsite |
shortText |
Cybersixgill Actionable Alerts
|
No |
0 |
|
Size - number of employees
|
sizenumberofemployees |
shortText |
Common Scripts
|
No |
0 |
|
Size - turnover
|
sizeturnover |
shortText |
Common Scripts
|
No |
0 |
|
Skyhigh Security Activity Count
|
skyhighsecurityactivitycount |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Activity Names
|
skyhighsecurityactivitynames |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Actor ID
|
skyhighsecurityactorid |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Actor ID Type
|
skyhighsecurityactoridtype |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Anomaly Category
|
skyhighsecurityanomalycategory |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Anomaly Cause
|
skyhighsecurityanomalycause |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Anomaly Count
|
skyhighsecurityanomalycount |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Anomaly IDs
|
skyhighsecurityanomalyids |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Anomaly Value
|
skyhighsecurityanomalyvalue |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Content Item Hierarchy
|
skyhighsecuritycontentitemhierarchy |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Content Item ID
|
skyhighsecuritycontentitemid |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Content Item Name
|
skyhighsecuritycontentitemname |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Content Item Parent
|
skyhighsecuritycontentitemparent |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Content Item Size
|
skyhighsecuritycontentitemsize |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Content Item Type
|
skyhighsecuritycontentitemtype |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Destination Hostname
|
skyhighsecuritydestinationhostname |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Device Type
|
skyhighsecuritydevicetype |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Is Part Of Threat
|
skyhighsecurityispartofthreat |
boolean |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Is Tokenized
|
skyhighsecurityistokenized |
boolean |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Malware Confidence
|
skyhighsecuritymalwareconfidence |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Match Count
|
skyhighsecuritymatchcount |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Resolution Action
|
skyhighsecurityresolutionaction |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Scan Name
|
skyhighsecurityscanname |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Scan Run Date
|
skyhighsecurityscanrundate |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Significantly Updated At
|
skyhighsecuritysignificantlyupdatedat |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Total Match Count
|
skyhighsecuritytotalmatchcount |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security URLs
|
skyhighsecurityurls |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security Unique Activity Names
|
skyhighsecurityuniqueactivitynames |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security User Attributes
|
skyhighsecurityuserattributes |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh Security content Item Created On
|
skyhighsecuritycontentitemcreatedon |
shortText |
Skyhigh Security SSE
|
No |
0 |
|
Skyhigh User Agent
|
skyhighsecurityuseragent |
multiSelect |
Skyhigh Security SSE
|
No |
0 |
|
Social Engineering Domain Analysis CSV
|
socialengineeringdomainanalysiscsv |
attachments |
Social Engineering Domain Analysis
|
No |
0 |
|
Social Engineering Domain Analysis List
|
socialengineeringdomainanalysislist |
longText |
Social Engineering Domain Analysis
|
No |
0 |
|
Social Engineering Domain Analysis Registered Domain
|
socialengineeringdomainanalysisregistereddomain |
shortText |
Social Engineering Domain Analysis
|
No |
0 |
|
Social Engineering Domain Analysis Summary
|
socialengineeringdomainanalysissummary |
html |
Social Engineering Domain Analysis
|
No |
0 |
|
SolarWinds Acknowledged
|
solarwindsacknowledged |
boolean |
SolarWinds
|
No |
0 |
|
SolarWinds Active Alert ID
|
solarwindsactivealertid |
number |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Acknowledged By
|
solarwindsalertacknowledgedby |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Acknowledged Date Time
|
solarwindsalertacknowledgeddatetime |
date |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Acknowledged Note
|
solarwindsalertacknowledgednote |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Created By
|
solarwindsalertcreatedby |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Entity Caption
|
solarwindsalertentitycaption |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Entity Details URI
|
solarwindsalertentitydetailsuri |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Entity NetObject ID
|
solarwindsalertentitynetobjectid |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Entity Type
|
solarwindsalertentitytype |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Entity URI
|
solarwindsalertentityuri |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert ID
|
solarwindsalertid |
number |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Name
|
solarwindsalertname |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Note
|
solarwindsalertnote |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Object ID
|
solarwindsalertobjectid |
number |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Real Entity Type
|
solarwindsalertrealentitytype |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Real Entity URI
|
solarwindsalertrealentityuri |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Reference ID
|
solarwindsalertreferenceid |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Related Node Caption
|
solarwindsalertrelatednodecaption |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Related Node Details URL
|
solarwindsalertrelatednodedetailsurl |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Related Node ID
|
solarwindsalertrelatednodeid |
number |
SolarWinds
|
No |
0 |
|
SolarWinds Alert Type
|
solarwindsalerttype |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Description
|
solarwindsdescription |
longText |
SolarWinds
|
No |
0 |
|
SolarWinds Display Name
|
solarwindsdisplayname |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Event Engine ID
|
solarwindseventengineid |
number |
SolarWinds
|
No |
0 |
|
SolarWinds Event ID
|
solarwindseventid |
number |
SolarWinds
|
No |
0 |
|
SolarWinds Event NetObject ID
|
solarwindseventnetobjectid |
number |
SolarWinds
|
No |
0 |
|
SolarWinds Event NetObject Type
|
solarwindseventnetobjecttype |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Event NetObject Value
|
solarwindseventnetobjectvalue |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Event Type
|
solarwindseventtype |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Instance Site ID
|
solarwindsinstancesiteid |
number |
SolarWinds
|
No |
0 |
|
SolarWinds Instance Type
|
solarwindsinstancetype |
shortText |
SolarWinds
|
No |
0 |
|
SolarWinds Message
|
solarwindsmessage |
longText |
SolarWinds
|
No |
0 |
|
SolarWinds URI
|
solarwindsuri |
shortText |
SolarWinds
|
No |
0 |
|
Source
|
source |
shortText |
FireMon Security Manager
|
No |
0 |
|
Source Category
|
sourcecategory |
shortText |
Common Types
|
No |
0 |
|
Source Create time
|
sourcecreatetime |
shortText |
Common Types
|
No |
0 |
|
Source Created By
|
sourcecreatedby |
shortText |
Common Types
|
No |
0 |
|
Source External IPs
|
sourceexternalips |
multiSelect |
Common Types
|
No |
0 |
|
Source Geolocation
|
sourcegeolocation |
multiSelect |
Common Types
|
No |
0 |
|
Source Hostname
|
sourcehostname |
shortText |
Common Types
|
No |
0 |
|
Source IP
|
sourceip |
shortText |
Common Types
|
No |
0 |
|
Source IP - Offense
|
sourceipoffense |
multiSelect |
IBM QRadar
|
No |
0 |
|
Source IPV6
|
sourceipv6 |
multiSelect |
Common Types
|
No |
0 |
|
Source IPs
|
sourceips |
multiSelect |
Common Types
|
No |
0 |
|
Source Id
|
sourceid |
shortText |
Common Types
|
No |
0 |
|
Source MAC Address
|
sourcemacaddress |
multiSelect |
Common Types
|
No |
0 |
|
Source Network
|
sourcenetwork |
shortText |
Common Types
|
No |
0 |
|
Source Network - Offense
|
sourcenetworkoffense |
multiSelect |
IBM QRadar
|
No |
0 |
|
Source Networks
|
sourcenetworks |
multiSelect |
Common Types
|
No |
0 |
|
Source Of Indicators
|
sourceofindicators |
grid |
Rapid Breach Response
|
No |
0 |
|
Source Port
|
sourceport |
shortText |
Common Types
|
No |
0 |
|
Source Priority
|
sourcepriority |
shortText |
Common Types
|
No |
0 |
|
Source Status
|
sourcestatus |
shortText |
Common Types
|
No |
0 |
|
Source Updated by
|
sourceupdatedby |
shortText |
Common Types
|
No |
0 |
|
Source Urgency
|
sourceurgency |
shortText |
Common Types
|
No |
0 |
|
Source Username
|
sourceusername |
shortText |
Common Types
|
No |
0 |
|
Source Zone Name
|
sourcezonename |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Splunk Comments
|
splunkcomments |
multiSelect |
Splunk
|
No |
0 |
|
Splunk Consolidated Findings
|
splunkconsolidatedfindings |
longText |
Splunk
|
No |
0 |
|
Splunk Dest Risk Object Type
|
splunkdestriskobjecttype |
shortText |
Splunk
|
No |
0 |
|
Splunk Dest Risk Score
|
splunkdestriskscore |
number |
Splunk
|
No |
0 |
|
Splunk Disposition
|
splunkdisposition |
singleSelect |
Splunk
|
No |
0 |
|
Splunk Drilldown
|
splunkdrilldown |
markdown |
Splunk
|
No |
0 |
|
Splunk ES Event Type
|
splunkeseventtype |
shortText |
Splunk
|
No |
0 |
|
Splunk Excluded Finding IDs
|
splunkexcludedfindingids |
multiSelect |
Splunk
|
No |
0 |
|
Splunk Implicit Finding IDs
|
splunkimplicitfindingids |
multiSelect |
Splunk
|
No |
0 |
|
Splunk Incident IDs
|
splunkincidentids |
multiSelect |
Splunk
|
No |
0 |
|
Splunk Incident Origin
|
splunkincidentorigin |
shortText |
Splunk
|
No |
0 |
|
Splunk Intermediate Finding IDs
|
splunkintermediatefindingids |
multiSelect |
Splunk
|
No |
0 |
|
Splunk Investigation GUID
|
splunkinvestigationguid |
shortText |
Splunk
|
No |
0 |
|
Splunk Investigation ID
|
splunkinvestigationid |
shortText |
Splunk
|
No |
0 |
|
Splunk Investigation Name
|
splunkinvestigationname |
shortText |
Splunk
|
No |
0 |
|
Splunk Investigation Type
|
splunkinvestigationtype |
shortText |
Splunk
|
No |
0 |
|
Splunk Notable Reviewer
|
splunknotablereviewer |
user |
Splunk
|
No |
0 |
|
Splunk Notes
|
splunknotes |
multiSelect |
Splunk
|
No |
0 |
|
Splunk Risk Object
|
splunkriskobject |
multiSelect |
Splunk
|
No |
0 |
|
Splunk Security Domain
|
splunksecuritydomain |
shortText |
Splunk
|
No |
0 |
|
Splunk Sensitivity
|
splunksensitivity |
shortText |
Splunk
|
No |
0 |
|
Splunk Status
|
splunkstatus |
singleSelect |
Splunk
|
No |
0 |
|
Splunk Urgency
|
splunkurgency |
singleSelect |
Splunk
|
No |
0 |
|
SpyCloud Compass Device-Data
|
spycloudcompassdevicedata |
grid |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Confidence
|
spycloudconfidence |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Document ID
|
spyclouddocumentid |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Email Domain
|
spycloudemaildomain |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Email Username
|
spycloudemailusername |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Infected Machine ID
|
spycloudinfectedmachineid |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Password
|
spycloudpassword |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Password Plaintext
|
spycloudpasswordplaintext |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Password Type
|
spycloudpasswordtype |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Publish Date
|
spycloudpublishdate |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Record Modification Date
|
spycloudrecordmodificationdate |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Target Domain
|
spycloudtargetdomain |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud Target Subdomain
|
spycloudtargetsubdomain |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud User Browser
|
spyclouduserbrowser |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud User SYS Registered Owner
|
spycloudusersysregisteredowner |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
SpyCloud User System Domain
|
spycloudusersystemdomain |
shortText |
SpyCloud Enterprise Protection
|
No |
0 |
|
Src
|
src |
shortText |
Common Types
|
No |
0 |
|
Src Hostname
|
srchostname |
shortText |
Common Types
|
No |
0 |
|
Src NT Domain
|
srcntdomain |
shortText |
Common Types
|
No |
0 |
|
Src OS
|
srcos |
shortText |
Common Types
|
No |
0 |
|
Src Ports
|
srcports |
multiSelect |
Common Types
|
No |
0 |
|
Src User
|
srcuser |
shortText |
Common Types
|
No |
0 |
|
Srcs
|
srcs |
multiSelect |
Common Types
|
No |
0 |
|
Stamus Host First Seen
|
stamushostfirstseen |
date |
Stamus
|
No |
0 |
|
Stamus Host Last Seen
|
stamushostlastseen |
date |
Stamus
|
No |
0 |
|
Stamus Host Roles
|
stamushostroles |
shortText |
Stamus
|
No |
0 |
|
StamusFamilyDescription
|
stamusfamilydescription |
shortText |
Stamus
|
No |
0 |
|
StamusFamilyID
|
stamusfamilyid |
shortText |
Stamus
|
No |
0 |
|
StamusFamilyLink
|
stamusfamilylink |
shortText |
Stamus
|
No |
0 |
|
StamusID
|
stamusid |
shortText |
Stamus
|
No |
0 |
|
StamusKillchain
|
stamuskillchain |
shortText |
Stamus
|
No |
0 |
|
StamusTarget
|
stamustarget |
shortText |
Stamus
|
No |
0 |
|
StamusTargettype
|
stamustargettype |
shortText |
Stamus
|
No |
0 |
|
StamusTenant
|
stamustenant |
shortText |
Stamus
|
No |
0 |
|
StamusThreatDescription
|
stamusthreatdescription |
shortText |
Stamus
|
No |
0 |
|
StamusThreatId
|
stamusthreatid |
shortText |
Stamus
|
No |
0 |
|
StamusThreatLink
|
stamusthreatlink |
shortText |
Stamus
|
No |
0 |
|
Starred
|
starred |
boolean |
Core Alert Fields
|
No |
0 |
|
Start Time
|
starttime |
shortText |
Common Types
|
No |
0 |
|
State
|
state |
shortText |
Common Types
|
No |
0 |
|
State CISO Notification
|
statecisonotification |
singleSelect |
Common Scripts
|
No |
0 |
|
State where the breach took place
|
statewherethebreachtookplace |
singleSelect |
Common Scripts
|
No |
0 |
|
Status - Offense
|
statusoffense |
shortText |
IBM QRadar
|
No |
0 |
|
Status Reason
|
statusreason |
shortText |
Common Types
|
No |
0 |
|
Stellar Cyber Case Alerts
|
stellarcybercasealerts |
grid |
Stellar Cyber
|
No |
0 |
|
Stellar Cyber Case Score
|
stellarcybercasescore |
number |
Stellar Cyber
|
No |
0 |
|
Stellar Cyber Tenant ID
|
stellarcybertenantid |
shortText |
Stellar Cyber
|
No |
0 |
|
Street Address
|
streetaddress |
shortText |
Common Types
|
No |
0 |
|
String Similarity Results
|
stringsimilarityresults |
markdown |
Common Types
|
No |
0 |
|
Sub Category
|
subcategory |
shortText |
Common Types
|
No |
0 |
|
Subscription Assigned By
|
subscriptionassignedby |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Subscription Created By
|
subscriptioncreatedby |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Subscription Created On
|
subscriptioncreatedon |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Subscription Description
|
subscriptiondescription |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Subscription ID
|
subscriptionid |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Subscription Name
|
subscriptionname |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Subscription Type
|
subscriptiontype |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Subscription Updated By
|
subscriptionupdatedby |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Subscription Updated On
|
subscriptionupdatedon |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Subtype
|
subtype |
shortText |
Common Types
|
No |
0 |
|
Successful Asset Enrichment
|
successfulassetenrichment |
shortText |
Splunk
|
No |
0 |
|
Successful Drilldown Enrichment
|
successfuldrilldownenrichment |
shortText |
Splunk
|
No |
0 |
|
Successful Identity Enrichment
|
successfulidentityenrichment |
shortText |
Splunk
|
No |
0 |
|
Successful Login
|
successfullogin |
shortText |
Brute Force
|
No |
0 |
|
Suggestions and discussion of how to improve the team
|
suggestionsanddiscussionofhowtoimprovetheteam |
shortText |
SANS
|
No |
0 |
|
Sumo Logic Cloud SIEM Insight Entity
|
sumologiccloudsieminsightentity |
grid |
Sumo Logic Cloud SIEM
|
No |
0 |
|
Sumo Logic Cloud SIEM Insight Involved Entities
|
sumologiccloudsieminsightinvolvedentities |
grid |
Sumo Logic Cloud SIEM
|
No |
0 |
|
Sumo Logic Cloud SIEM Insight Signals
|
sumologiccloudsieminsightsignals |
grid |
Sumo Logic Cloud SIEM
|
No |
0 |
|
Sumo Logic Cloud SIEM Insight URL
|
sumologiccloudsieminsighturl |
url |
Sumo Logic Cloud SIEM
|
No |
0 |
|
Sumo Logic Cloud SIEM Record Fields
|
sumologiccloudsiemrecordfields |
grid |
Sumo Logic Cloud SIEM
|
No |
0 |
|
Sumo Logic Cloud SIEM Record Fields JSON
|
sumologiccloudsiemrecordfieldsjson |
markdown |
Sumo Logic Cloud SIEM
|
No |
0 |
|
Sumo Logic Cloud SIEM Signal Entity
|
sumologiccloudsiemsignalentity |
grid |
Sumo Logic Cloud SIEM
|
No |
0 |
|
Sumo Logic Cloud SIEM Signal Records
|
sumologiccloudsiemsignalrecords |
grid |
Sumo Logic Cloud SIEM
|
No |
0 |
|
Surname
|
surname |
shortText |
Common Types
|
No |
0 |
|
Suspicious Activity End Time
|
suspiciousactivityendtime |
date |
Microsoft Advanced Threat Analytics
|
No |
0 |
|
Suspicious Activity ID
|
suspiciousactivityid |
shortText |
Microsoft Advanced Threat Analytics
|
No |
0 |
|
Suspicious Activity Severity
|
suspiciousactivityseverity |
singleSelect |
Microsoft Advanced Threat Analytics
|
No |
0 |
|
Suspicious Activity Start Time
|
suspiciousactivitystarttime |
date |
Microsoft Advanced Threat Analytics
|
No |
0 |
|
Suspicious Activity Status
|
suspiciousactivitystatus |
singleSelect |
Microsoft Advanced Threat Analytics
|
No |
0 |
|
Suspicious Executions
|
suspiciousexecutions |
grid |
Common Types
|
No |
0 |
|
Suspicious Executions Found
|
suspiciousexecutionsfound |
markdown |
Common Types
|
No |
0 |
|
Switch ID - Asset
|
switchidasset |
multiSelect |
Asset
|
No |
0 |
|
Switch Port ID - Asset
|
switchportidasset |
multiSelect |
Asset
|
No |
0 |
|
Symantec ESC Detection Method
|
symantecescdetectionmethod |
shortText |
SymantecEmailSecurity
|
No |
0 |
|
Symantec ESC Email Attachment
|
symantecescemailattachment |
markdown |
SymantecEmailSecurity
|
No |
0 |
|
Symantec ESC Email Body
|
symantecescemailbody |
html |
SymantecEmailSecurity
|
No |
0 |
|
Symantec ESC Email Direction
|
symantecescemaildirection |
shortText |
SymantecEmailSecurity
|
No |
0 |
|
Symantec ESC Email Malware Category
|
symantecescemailmalwarecategory |
shortText |
SymantecEmailSecurity
|
No |
0 |
|
Symantec ESC Email Malware Name
|
symantecescemailmalwarename |
shortText |
SymantecEmailSecurity
|
No |
0 |
|
Symantec ESC Email Recipient
|
symantecescemailrecipient |
shortText |
SymantecEmailSecurity
|
No |
0 |
|
Symantec ESC Email Sender
|
symantecescemailsender |
shortText |
SymantecEmailSecurity
|
No |
0 |
|
Symantec ESC Email Subject
|
symantecescemailsubject |
shortText |
SymantecEmailSecurity
|
No |
0 |
|
Symantec ESC Quarantine Rule
|
symantecescquarantinerule |
shortText |
SymantecEmailSecurity
|
No |
0 |
|
Symantec ESC Security Service
|
symantecescsecurityservice |
shortText |
SymantecEmailSecurity
|
No |
0 |
|
SymantecEDR Antivirus
|
symantecedrantivirus |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Detection Type
|
symantecedrdetectiontype |
shortText |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Enriched Data
|
symantecedrenricheddata |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Event Actor
|
symantecedreventactor |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Event Actor File
|
symantecedreventactorfile |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Event Actor User
|
symantecedreventactoruser |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Event Process
|
symantecedreventprocess |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Event Type ID
|
symantecedreventtypeid |
shortText |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Incident Comments
|
symantecedrincidentcomments |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Incident Events
|
symantecedrincidentevents |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Intrusion
|
symantecedrintrusion |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Log Name
|
symantecedrlogname |
shortText |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Process File
|
symantecedrprocessfile |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Process User
|
symantecedrprocessuser |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Recommended Action
|
symantecedrrecommendedaction |
longText |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Rule ID
|
symantecedrruleid |
shortText |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Scan
|
symantecedrscan |
shortText |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR Threat
|
symantecedrthreat |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SymantecEDR attacks
|
symantecedrattacks |
grid |
Symantec Endpoint Detection and Response
|
No |
0 |
|
SysAid Asset Name
|
sysaidassetname |
shortText |
SysAid
|
No |
0 |
|
SysAid Category
|
sysaidcategory |
shortText |
SysAid
|
No |
0 |
|
SysAid Company
|
sysaidcompany |
shortText |
SysAid
|
No |
0 |
|
SysAid Due Date
|
sysaidduedate |
shortText |
SysAid
|
No |
0 |
|
SysAid Notes
|
sysaidnotes |
shortText |
SysAid
|
No |
0 |
|
SysAid Parent ID
|
sysaidparentid |
shortText |
SysAid
|
No |
0 |
|
SysAid Resolution
|
sysaidresolution |
shortText |
SysAid
|
No |
0 |
|
SysAid Solution
|
sysaidsolution |
shortText |
SysAid
|
No |
0 |
|
SysAid Sub Category
|
sysaidsubcategory |
shortText |
SysAid
|
No |
0 |
|
SysAid Tertiary Category
|
sysaidtertiarycategory |
shortText |
SysAid
|
No |
0 |
|
Sysdig Agent ID
|
sysdigagentid |
shortText |
Sysdig Response Actions
|
No |
0 |
|
Sysdig Container ID
|
sysdigcontainerid |
shortText |
Sysdig Response Actions
|
No |
0 |
|
Sysdig Customer ID
|
sysdigcustomerid |
shortText |
Sysdig Response Actions
|
No |
0 |
|
System Default
|
systemdefault |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
TIM Campaign Threat Alias
|
timcampaignthreatalias |
tagsSelect |
TIM Campaign Tracking
|
No |
0 |
|
TIM Campaign Threat Detected
|
timcampaignthreatdetected |
boolean |
TIM Campaign Tracking
|
No |
0 |
|
TIM Campaign Threat Goals
|
timcampaignthreatgoals |
shortText |
TIM Campaign Tracking
|
No |
0 |
|
TIM Campaign Threat Motivation
|
timcampaignthreatmotivation |
shortText |
TIM Campaign Tracking
|
No |
0 |
|
TOPdesk Call Type
|
topdeskcalltype |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Caller Branch Name
|
topdeskcallerbranchname |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Caller Name
|
topdeskcallername |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Category
|
topdeskcategory |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Creation Date
|
topdeskcreationdate |
date |
TOPdesk
|
No |
0 |
|
TOPdesk Creator
|
topdeskcreator |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Duration
|
topdeskduration |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Entry Type
|
topdeskentrytype |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Impact
|
topdeskimpact |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Line
|
topdeskline |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk MainIncident
|
topdeskmainincident |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Modification Date
|
topdeskmodificationdate |
date |
TOPdesk
|
No |
0 |
|
TOPdesk Modifier
|
topdeskmodifier |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Number
|
topdeskincidentnumber |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Priority
|
topdeskpriority |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Processing Status
|
topdeskprocessingstatus |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Subcategory
|
topdesksubcategory |
shortText |
TOPdesk
|
No |
0 |
|
TOPdesk Urgency
|
topdeskurgency |
shortText |
TOPdesk
|
No |
0 |
|
Tactic
|
tactic |
multiSelect |
Common Types
|
No |
0 |
|
Tactic ID
|
tacticid |
multiSelect |
Common Types
|
No |
0 |
|
Tags
|
tags |
tagsSelect |
Common Types
|
No |
0 |
|
Tanium Threat Response Event Id
|
taniumthreatresponseeventid |
shortText |
Tanium Threat Response
|
No |
0 |
|
Tanium Threat Response GUID
|
taniumthreatresponseguid |
shortText |
Tanium Threat Response
|
No |
0 |
|
Tanium Threat Response Intel Doc Id
|
taniumthreatresponseinteldocid |
shortText |
Tanium Threat Response
|
No |
0 |
|
Tanium Threat Response Intel Doc Revision Id
|
taniumthreatresponseinteldocrevisionid |
shortText |
Tanium Threat Response
|
No |
0 |
|
Tanium Threat Response Priority
|
taniumthreatresponsepriority |
shortText |
Tanium Threat Response
|
No |
0 |
|
Tanium Threat Response Scan Config Id
|
taniumtreatresponsescanconfigid |
shortText |
Tanium Threat Response
|
No |
0 |
|
Tanium Threat Response Scan Config Revision Id
|
taniumthreatresponsescanconfigrevisionid |
shortText |
Tanium Threat Response
|
No |
0 |
|
Tanium Threat Response Type
|
taniumthreatresponsetype |
shortText |
Tanium Threat Response
|
No |
0 |
|
Target
|
target |
shortText |
PAN-OS by Palo Alto Networks
|
No |
0 |
|
Target Firewall Version
|
targetfirewallversion |
shortText |
PAN-OS by Palo Alto Networks
|
No |
0 |
|
Target process CMD
|
targetprocesscmd |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Target process SHA256
|
targetprocesssha256 |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Target process name
|
targetprocessname |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Team name
|
teamname |
shortText |
Common Types
|
No |
0 |
|
Technical Owner
|
technicalowner |
multiSelect |
Common Types
|
No |
0 |
|
Technical Owner Contact
|
technicalownercontact |
multiSelect |
Common Types
|
No |
0 |
|
Technical User
|
technicaluser |
multiSelect |
Common Types
|
No |
0 |
|
Technique
|
technique |
multiSelect |
Common Types
|
No |
0 |
|
Technique Best Practice
|
techniquebestpractice |
shortText |
XM Cyber
|
No |
0 |
|
Technique ID
|
techniqueid |
multiSelect |
Common Types
|
No |
0 |
|
Technique name
|
techniquename |
shortText |
XM Cyber
|
No |
0 |
|
Techniques List
|
techniqueslist |
longText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Techniques to Handle
|
techniquestohandle |
markdown |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Telephone no.
|
telephoneno |
shortText |
Common Scripts
|
No |
0 |
|
Tenant Name
|
tenantname |
shortText |
Common Types
|
No |
0 |
|
Terminated Action
|
terminatedaction |
shortText |
Malware Core
|
No |
0 |
|
TheHive Case PAP
|
thehivecasepap |
singleSelect |
TheHive Project
|
No |
0 |
|
TheHive Case Resolution Status
|
thehivecaseresolutionstatus |
singleSelect |
TheHive Project
|
No |
0 |
|
TheHive Case Status
|
thehivecasestatus |
singleSelect |
TheHive Project
|
No |
0 |
|
TheHive Case Summary
|
thehivecasesummary |
longText |
TheHive Project
|
No |
0 |
|
TheHive Case TLP
|
thehivecasetlp |
singleSelect |
TheHive Project
|
No |
0 |
|
TheHive Flag
|
thehiveflag |
boolean |
TheHive Project
|
No |
0 |
|
TheHive Observables
|
thehiveobservables |
grid |
TheHive Project
|
No |
0 |
|
TheHive Tasks
|
thehivetasks |
grid |
TheHive Project
|
No |
0 |
|
Thinkst Canary Flock Id
|
thinkstcanaryflockid |
shortText |
Thinkst Canary
|
No |
0 |
|
Thinkst Canary Flock Name
|
thinkstcanaryflockname |
shortText |
Thinkst Canary
|
No |
0 |
|
Thinkst Canary Node Id
|
thinkstcanarynodeid |
shortText |
Thinkst Canary
|
No |
0 |
|
Third Party Integrations
|
thirdpartyintegrations |
markdown |
Use Case Builder
|
No |
0 |
|
Threat Actor
|
threatactor |
shortText |
Malware Core
|
No |
0 |
|
Threat Family Name
|
threatfamilyname |
shortText |
Common Types
|
No |
0 |
|
Threat Hunting Detected Hostnames
|
threathuntingdetectedhostnames |
multiSelect |
Common Types
|
No |
0 |
|
Threat Hunting Detected IP
|
threathuntingdetectedip |
multiSelect |
Common Types
|
No |
0 |
|
Threat Name
|
threatname |
shortText |
Common Types
|
No |
0 |
|
Threat Vault by Palo Alto Networks Applications
|
threatvaultbypaloaltonetworksapplications |
grid |
Threat Vault by Palo Alto Networks
|
No |
0 |
|
Threat Vault by Palo Alto Networks Content Version
|
threatvaultbypaloaltonetworkscontentversion |
shortText |
Threat Vault by Palo Alto Networks
|
No |
0 |
|
Threat Vault by Palo Alto Networks Release Version
|
threatvaultbypaloaltonetworksreleaseversion |
shortText |
Threat Vault by Palo Alto Networks
|
No |
0 |
|
Threat Vault by Palo Alto Networks Spyware
|
threatvaultbypaloaltonetworksspyware |
grid |
Threat Vault by Palo Alto Networks
|
No |
0 |
|
Threat Vault by Palo Alto Networks Vulnerability
|
threatvaultbypaloaltonetworksvulnerability |
grid |
Threat Vault by Palo Alto Networks
|
No |
0 |
|
Threat Vault by Palo Alto Networks data correlation
|
threatvaultbypaloaltonetworksdatacorrelation |
grid |
Threat Vault by Palo Alto Networks
|
No |
0 |
|
Threat Vault by Palo Alto Networks decoders
|
threatvaultbypaloaltonetworksdecoders |
grid |
Threat Vault by Palo Alto Networks
|
No |
0 |
|
Threat Vault by Palo Alto Networks file type
|
threatvaultbypaloaltonetworksfiletype |
grid |
Threat Vault by Palo Alto Networks
|
No |
0 |
|
Threat Vault by Palo Alto Networks release notes
|
threatvaultbypaloaltonetworksreleasenotes |
html |
Threat Vault by Palo Alto Networks
|
No |
0 |
|
ThreatConnect Associated Indicators
|
threatconnectassociatedindicators |
grid |
ThreatConnect
|
No |
0 |
|
ThreatConnect AssociatedGroups
|
threatconnectassociatedgroups |
grid |
ThreatConnect
|
No |
0 |
|
ThreatConnect Attributes
|
threatconnectattributes |
grid |
ThreatConnect
|
No |
0 |
|
ThreatConnect Created By
|
threatconnectcreatedby |
grid |
ThreatConnect
|
No |
0 |
|
ThreatConnect Event Date
|
threatconnecteventdate |
shortText |
ThreatConnect
|
No |
0 |
|
ThreatConnect Group Type
|
threatconnectgrouptype |
shortText |
ThreatConnect
|
No |
0 |
|
ThreatConnect Id
|
threatconnectid |
shortText |
ThreatConnect
|
No |
0 |
|
ThreatConnect Security Labels
|
threatconnectsecuritylabels |
grid |
ThreatConnect
|
No |
0 |
|
ThreatConnect Victim Assets
|
threatconnectvictimassets |
grid |
ThreatConnect
|
No |
0 |
|
Ticket Acknowledged Date
|
ticketacknowledgeddate |
date |
Common Types
|
No |
0 |
|
Ticket Closed Date
|
ticketcloseddate |
date |
Common Types
|
No |
0 |
|
Ticket Number
|
ticketnumber |
shortText |
Common Types
|
No |
0 |
|
Ticket Opened Date
|
ticketopeneddate |
date |
Common Types
|
No |
0 |
|
TidyGitHubToken
|
tidygithubtoken |
shortText |
Tidy
|
No |
0 |
|
TidyHost
|
tidyhost |
shortText |
Tidy
|
No |
0 |
|
TidyPassword
|
tidypassword |
shortText |
Tidy
|
No |
0 |
|
TidyUser
|
tidyuser |
shortText |
Tidy
|
No |
0 |
|
Time to Assignment
|
timetoassignment |
timer |
Common Types
|
No |
0 |
|
Time to Investigate
|
timetoinvestigate |
timer |
Use Case Builder
|
No |
0 |
|
Time to Remediate
|
timetoremediate |
timer |
Use Case Builder
|
No |
0 |
|
Time to Triage
|
timetotriage |
timer |
Use Case Builder
|
No |
0 |
|
Timestamp
|
timestamp |
date |
Core Alert Fields
|
No |
0 |
|
Timezone
|
timezone |
shortText |
Common Types
|
No |
0 |
|
Titan URL
|
titanurl |
url |
Intel471 Feed
|
No |
0 |
|
Titan Watcher
|
titanwatcher |
shortText |
Intel471 Feed
|
No |
0 |
|
Titan Watcher Group
|
titanwatchergroup |
shortText |
Intel471 Feed
|
No |
0 |
|
Title
|
title |
shortText |
Common Types
|
No |
0 |
|
To join the meeting
|
tojointhemeeting |
markdown |
Shift Management
|
No |
0 |
|
To start the meeting
|
tostartthemeeting |
markdown |
Shift Management
|
No |
0 |
|
Tool Usage Found
|
toolusagefound |
tagsSelect |
Common Types
|
No |
0 |
|
Tools
|
tools |
tagsSelect |
Common Types
|
No |
0 |
|
Tools To Hunt For
|
toolstohuntfor |
tagsSelect |
Proactive Threat Hunting
|
No |
0 |
|
Total Failed Instances
|
totalfailedinstances |
number |
Integrations & Incidents Health Check
|
No |
0 |
|
Total Good Instances
|
totalgoodinstances |
number |
Integrations & Incidents Health Check
|
No |
0 |
|
Total Indicator Count
|
totalindicatorcount |
shortText |
Rapid Breach Response
|
No |
0 |
|
Total Instances
|
totalinstances |
number |
Integrations & Incidents Health Check
|
No |
0 |
|
Total Malicious URLs Clicks
|
totalmaliciousurlsclicks |
number |
Phishing
|
No |
0 |
|
Total Task Count
|
totaltaskcount |
shortText |
Rapid Breach Response
|
No |
0 |
|
Traffic Direction
|
trafficdirection |
multiSelect |
Common Types
|
No |
0 |
|
Traps ID
|
trapsid |
shortText |
Palo Alto Networks Traps (Deprecated)
|
No |
0 |
|
Travel Map Link
|
travelmaplink |
shortText |
Impossible Traveler
|
No |
0 |
|
Trello Board ID
|
trelloboardid |
shortText |
Trello
|
No |
0 |
|
Trello Board Name
|
trelloboardname |
shortText |
Trello
|
No |
0 |
|
Trello Card ID
|
trellocardid |
shortText |
Trello
|
No |
0 |
|
Trello Card URL
|
trellocardurl |
url |
Trello
|
No |
0 |
|
Trello Created By
|
trellocreatedby |
shortText |
Trello
|
No |
0 |
|
Trello Details
|
trellodetails |
markdown |
Trello
|
No |
0 |
|
Trello List ID
|
trellolistid |
shortText |
Trello
|
No |
0 |
|
Trello List Name
|
trellolistname |
shortText |
Trello
|
No |
0 |
|
Trello SLA
|
trellosla |
timer |
Trello
|
No |
0 |
|
Trend Micro Vision One XDR Account Count
|
trendmicrovisiononexdraccountcount |
number |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Desktop Count
|
trendmicrovisiononexdrdesktopcount |
number |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Detail
|
trendmicrovisiononexdrdetail |
markdown |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Email Address Count
|
trendmicrovisiononexdremailaddresscount |
number |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Impact Scope
|
trendmicrovisiononexdrimpactscope |
markdown |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Impacted Entities
|
trendmicrovisiononexdrimpactedentities |
markdown |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Impacted Entities JSON
|
trendmicrovisiononexdrimpactedentitiesjson |
shortText |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Indicators
|
trendmicrovisiononexdrindicators |
markdown |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Indicators JSON
|
trendmicrovisiononexdrindicatorsjson |
shortText |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Investigation Status
|
trendmicrovisiononexdrinvestigationstatus |
shortText |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Matched Rules JSON
|
trendmicrovisiononexdrmatchedrulesjson |
shortText |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Priority Score
|
trendmicrovisiononexdrpriorityscore |
shortText |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Server Count
|
trendmicrovisiononexdrservercount |
number |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Workbench ID
|
trendmicrovisiononexdrworkbenchid |
shortText |
TrendAI Vision One™
|
No |
0 |
|
Trend Micro Vision One XDR Workbench Link
|
trendmicrovisiononexdrworkbenchlink |
url |
TrendAI Vision One™
|
No |
0 |
|
Triage SLA
|
triagesla |
timer |
Common Types
|
No |
0 |
|
Trigger
|
trigger |
markdown |
Use Case Builder
|
No |
0 |
|
Triggered Security Profile
|
triggeredsecurityprofile |
shortText |
Common Types
|
No |
0 |
|
Troubleshoot Summary
|
troubleshootsummary |
markdown |
Troubleshoot
|
No |
0 |
|
Troubleshoot type
|
troubleshoottype |
singleSelect |
Troubleshoot
|
No |
0 |
|
Type - Offense
|
typeoffense |
shortText |
IBM QRadar
|
No |
0 |
|
URL
|
url |
multiSelect |
Core Alert Fields
|
No |
0 |
|
URL Filtering Profile Name
|
urlfilteringprofilename |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
URL Filtering Profile Status
|
urlfilteringprofilestatus |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
URL Filtering Rules
|
urlfilteringrules |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
URL SSL Verification
|
urlsslverification |
grid |
Common Types
|
No |
0 |
|
URLs
|
urls |
multiSelect |
Common Types
|
No |
0 |
|
USTA Account Takeover Prevention Created
|
ustaaccounttakeoverpreventioncreated |
date |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention ID
|
ustaaccounttakeoverpreventionid |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Is Corporate
|
ustaaccounttakeoverpreventioniscorporate |
boolean |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Password
|
ustaaccounttakeoverpreventionpassword |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Source
|
ustaaccounttakeoverpreventionsource |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention URL
|
ustaaccounttakeoverpreventionurl |
url |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Username
|
ustaaccounttakeoverpreventionusername |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details CPU
|
ustaaccounttakeoverpreventionvictimdetailscpu |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details Computer Name
|
ustaaccounttakeoverpreventionvictimdetailscomputername |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details Computer Username
|
ustaaccounttakeoverpreventionvictimdetailscomputerusername |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details Country
|
ustaaccounttakeoverpreventionvictimdetailscountry |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details GPU
|
ustaaccounttakeoverpreventionvictimdetailsgpu |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details IP Adress
|
ustaaccounttakeoverpreventionvictimdetailsipadress |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details Infection Date
|
ustaaccounttakeoverpreventionvictimdetailsinfectiondate |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details Language
|
ustaaccounttakeoverpreventionvictimdetailslanguage |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details Malware
|
ustaaccounttakeoverpreventionvictimdetailsmalware |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details Memory
|
ustaaccounttakeoverpreventionvictimdetailsmemory |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details Phone Number
|
ustaaccounttakeoverpreventionvictimdetailsphonenumber |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
USTA Account Takeover Prevention Victim Details Victim OS
|
ustaaccounttakeoverpreventionvictimdetailsvictimos |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
UUID
|
uuid |
shortText |
Common Types
|
No |
0 |
|
Unassigned Incidents
|
unassignedincidents |
multiSelect |
Integrations & Incidents Health Check
|
No |
0 |
|
Unhandled Techniques
|
unhandledtechniques |
grid |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
UnifiVideo Camera Name
|
unifivideocameraname |
shortText |
UnifiVideo NVR
|
No |
0 |
|
UnifiVideo End Time
|
unifivideoendtime |
shortText |
UnifiVideo NVR
|
No |
0 |
|
UnifiVideo Start Time
|
unifivideostarttime |
shortText |
UnifiVideo NVR
|
No |
0 |
|
UnifiVideo Ubnt ID
|
unifivideoubntid |
shortText |
UnifiVideo NVR
|
No |
0 |
|
Unique Ports
|
uniqueports |
shortText |
Common Types
|
No |
0 |
|
Unique biometric data breached
|
uniquebiometricdatabreached |
shortText |
Common Scripts
|
No |
0 |
|
Unique identification number breached
|
uniqueidentificationnumberbreached |
shortText |
Common Scripts
|
No |
0 |
|
Use Case Backlog Timer
|
usecasebacklogtimer |
timer |
Use Case Builder
|
No |
0 |
|
Use Case Builder Authentication
|
usecasebuilderauthentication |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Builder Auto Generator Key
|
usecasebuilderautogeneratorkey |
number |
Use Case Builder
|
No |
0 |
|
Use Case Builder Case Management
|
usecasebuildercasemanagement |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Builder Data Enrichment and Threat Intelligence
|
usecasebuilderdataenrichmentandthreatintelligence |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Builder Development Deadline
|
usecasebuilderdevelopmentdeadline |
timer |
Use Case Builder
|
No |
0 |
|
Use Case Builder Email Gateway
|
usecasebuilderemailgateway |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Builder Endpoint
|
usecasebuilderendpoint |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Builder Forensics and Malware Analysis
|
usecasebuilderforensicsandmalwareanalysis |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Builder Getting Started
|
usecasebuildergettingstarted |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Builder IAM
|
usecasebuilderiam |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Builder Network Security NGFW
|
usecasebuildernetworksecurityngfw |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Builder Playbook Generator Key
|
usecasebuilderplaybookgeneratorkey |
number |
Use Case Builder
|
No |
0 |
|
Use Case Builder SEIM
|
usecasebuilderseim |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Builder Use Case Containment Steps
|
usecasebuilderusecasecontainmentsteps |
multiSelect |
Use Case Builder
|
No |
0 |
|
Use Case Builder Vulnerability Management
|
usecasebuildervulnerabilitymanagement |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Category
|
usecasecategory |
singleSelect |
Use Case Builder
|
No |
0 |
|
Use Case Description
|
usecasedescription |
markdown |
Common Types
|
No |
0 |
|
Use Case Design Best Practice
|
usecasedesignbestpractice |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Development Stage
|
usecasedevelopmentstage |
singleSelect |
Use Case Builder
|
No |
0 |
|
Use Case Development Timer
|
usecasedevelopmenttimer |
timer |
Use Case Builder
|
No |
0 |
|
Use Case Enrichment Actions
|
usecaseenrichmentactions |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Enrichment Steps
|
usecaseenrichmentsteps |
multiSelect |
Use Case Builder
|
No |
0 |
|
Use Case Ingestion Best Practice
|
usecaseingestionbestpractice |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Initiator
|
usecaseinitiator |
singleSelect |
Use Case Builder
|
No |
0 |
|
Use Case Name
|
usecasename |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Pre-Production Timer
|
usecasepreproductiontimer |
timer |
Use Case Builder
|
No |
0 |
|
Use Case Priority
|
usecasepriority |
singleSelect |
Use Case Builder
|
No |
0 |
|
Use Case Production Timer
|
usecaseproductiontimer |
timer |
Use Case Builder
|
No |
0 |
|
Use Case Purpose
|
usecasepurpose |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Required Metrics and Notifications
|
usecaserequiredmetricsandnotifications |
multiSelect |
Use Case Builder
|
No |
0 |
|
Use Case SLAs
|
usecaseslas |
multiSelect |
Use Case Builder
|
No |
0 |
|
Use Case TIM Best Practice
|
usecasetimbestpractice |
markdown |
Use Case Builder
|
No |
0 |
|
Use Case Testing Timer
|
usecasetestingtimer |
timer |
Use Case Builder
|
No |
0 |
|
Use Case Type
|
usecasetype |
singleSelect |
Use Case Builder
|
No |
0 |
|
UseCaseAdoptionMetrics
|
usecaseadoptionmetrics |
markdown |
Use Case Builder
|
No |
0 |
|
User
|
user |
shortText |
Malware Core
|
No |
0 |
|
User Agent
|
useragent |
multiSelect |
Common Types
|
No |
0 |
|
User Agent
|
useragent |
multiSelect |
Core Alert Fields
|
No |
0 |
|
User Anomaly Count
|
useranomalycount |
shortText |
Common Types
|
No |
0 |
|
User Block Status
|
userblockstatus |
shortText |
Common Types
|
No |
0 |
|
User Creation Time
|
usercreationtime |
shortText |
Common Types
|
No |
0 |
|
User Disabled Status
|
userdisabledstatus |
shortText |
Brute Force
|
No |
0 |
|
User Engagement Response
|
userengagementresponse |
shortText |
Common Types
|
No |
0 |
|
User Groups
|
usergroups |
multiSelect |
Common Types
|
No |
0 |
|
User Id
|
userid |
shortText |
Common Types
|
No |
0 |
|
User Risk Level
|
userrisklevel |
shortText |
Common Types
|
No |
0 |
|
User Risk Level
|
userrisklevel |
shortText |
Core Alert Fields
|
No |
0 |
|
User Risk Reasons
|
userriskreasons |
multiSelect |
Core Alert Fields
|
No |
0 |
|
User SID
|
usersid |
multiSelect |
Common Types
|
No |
0 |
|
User name
|
username |
multiSelect |
Core Alert Fields
|
No |
0 |
|
Username
|
username |
shortText |
Common Types
|
No |
0 |
|
Username Count - Offense
|
usernamecountoffense |
number |
IBM QRadar
|
No |
0 |
|
Usernames
|
usernames |
multiSelect |
Common Types
|
No |
0 |
|
Users
|
users |
multiSelect |
Common Types
|
No |
0 |
|
Users Details
|
usersdetails |
markdown |
Common Types
|
No |
0 |
|
Usta Alert URL
|
ustaalerturl |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
Usta Stolen Credit Cards Card Number
|
ustastolencreditcardscardnumber |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
Usta Stolen Credit Cards Created
|
ustastolencreditcardscreated |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
Usta Stolen Credit Cards Expire Date
|
ustastolencreditcardsexpiredate |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
Usta Stolen Credit Cards Id
|
ustastolencreditcardsid |
shortText |
USTA Cyber Threat Intelligence Platform
|
No |
0 |
|
VM - Asset Owner
|
vmassetowner |
grid |
Cortex Vulnerability Management
|
No |
0 |
|
VM - Asset Owner Unranked Raw
|
vmassetownerunrankedraw |
grid |
Cortex Vulnerability Management
|
No |
0 |
|
VPC ID
|
vpcid |
shortText |
Prisma Cloud by Palo Alto Networks
|
No |
0 |
|
Varonis Data Security Platform Alert Status
|
varonisdatasecurityplatformalertstatus |
shortText |
Varonis Data Security Platform
|
No |
0 |
|
Varonis Data Security Platform Close Reason
|
varonisdatasecurityplatformclosereason |
shortText |
Varonis Data Security Platform
|
No |
0 |
|
Varonis Data Security Platform Contains Flagged Data
|
varonisdatasecurityplatformcontainsflaggeddata |
boolean |
Varonis Data Security Platform
|
No |
0 |
|
Varonis Data Security Platform Contains Malicious External IP
|
varonisdatasecurityplatformcontainsmaliciousexternalip |
boolean |
Varonis Data Security Platform
|
No |
0 |
|
Varonis Data Security Platform Contains Sensitive Data
|
varonisdatasecurityplatformcontainssensitivedata |
boolean |
Varonis Data Security Platform
|
No |
0 |
|
Varonis Data Security Platform Devices
|
varonisdatasecurityplatformdevices |
grid |
Varonis Data Security Platform
|
No |
0 |
|
Varonis Data Security Platform Locations
|
varonisdatasecurityplatformlocations |
grid |
Varonis Data Security Platform
|
No |
0 |
|
Varonis Data Security Platform Number of Events
|
varonisdatasecurityplatformnumberofevents |
number |
Varonis Data Security Platform
|
No |
0 |
|
Varonis Data Security Platform Sources
|
varonisdatasecurityplatformsources |
grid |
Varonis Data Security Platform
|
No |
0 |
|
Varonis Data Security Platform Users
|
varonisdatasecurityplatformusers |
grid |
Varonis Data Security Platform
|
No |
0 |
|
Varonis SaaS Alert Status
|
varonissaasalertstatus |
singleSelect |
Varonis SaaS
|
No |
0 |
|
Varonis SaaS Close Reason
|
varonissaasclosereason |
singleSelect |
Varonis SaaS
|
No |
0 |
|
Varonis SaaS Contains Flagged Data
|
varonissaascontainsflaggeddata |
boolean |
Varonis SaaS
|
No |
0 |
|
Varonis SaaS Contains Malicious External IP
|
varonissaascontainsmaliciousexternalip |
boolean |
Varonis SaaS
|
No |
0 |
|
Varonis SaaS Contains Sensitive Data
|
varonissaascontainssensitivedata |
boolean |
Varonis SaaS
|
No |
0 |
|
Varonis SaaS Devices
|
varonissaasdevices |
grid |
Varonis SaaS
|
No |
0 |
|
Varonis SaaS Locations
|
varonissaaslocations |
grid |
Varonis SaaS
|
No |
0 |
|
Varonis SaaS Number of Events
|
varonissaasnumberofevents |
number |
Varonis SaaS
|
No |
0 |
|
Varonis SaaS Sources
|
varonissaassources |
grid |
Varonis SaaS
|
No |
0 |
|
Varonis SaaS Users
|
varonissaasusers |
grid |
Varonis SaaS
|
No |
0 |
|
Vectra Account Host Access History
|
vectraaccounthostaccesshistory |
grid |
Vectra AI
|
No |
0 |
|
Vectra Account Type
|
vectraaccounttype |
shortText |
Vectra AI
|
No |
0 |
|
Vectra Assigned By
|
vectraassignedby |
shortText |
Vectra AI
|
No |
0 |
|
Vectra Assigned Date
|
vectraassigneddate |
date |
Vectra AI
|
No |
0 |
|
Vectra Assigned To
|
vectraassignedto |
shortText |
Vectra AI
|
No |
0 |
|
Vectra Assignment ID
|
vectraassignmentid |
shortText |
Vectra AI
|
No |
0 |
|
Vectra Assignment Outcome
|
vectraassignmentoutcome |
shortText |
Vectra AI
|
No |
0 |
|
Vectra Assignment Resolved By
|
vectraassignmentresolvedby |
shortText |
Vectra AI
|
No |
0 |
|
Vectra Assignment Resolved Date
|
vectraassignmentresolveddate |
date |
Vectra AI
|
No |
0 |
|
Vectra Certainty Score
|
vectracertaintyscore |
number |
Vectra AI
|
No |
0 |
|
Vectra Detection Count
|
vectradetectioncount |
number |
Vectra AI
|
No |
0 |
|
Vectra Detection Details
|
vectradetectiondetails |
multiSelect |
Vectra AI
|
No |
0 |
|
Vectra Detection Profile
|
vectradetectionprofile |
shortText |
Vectra AI
|
No |
0 |
|
Vectra Entity Type
|
vectraentitytype |
shortText |
Vectra AI
|
No |
0 |
|
Vectra Groups
|
vectragroups |
grid |
Vectra AI
|
No |
0 |
|
Vectra Host Account Access History
|
vectrahostaccountaccesshistory |
grid |
Vectra AI
|
No |
0 |
|
Vectra Host Active Traffic
|
vectrahostactivetraffic |
boolean |
Vectra AI
|
No |
0 |
|
Vectra Host Artifact Set
|
vectrahostartifactset |
markdown |
Vectra AI
|
No |
0 |
|
Vectra Host Key Asset
|
vectrahostkeyasset |
boolean |
Vectra AI
|
No |
0 |
|
Vectra Host Previous IPs
|
vectrahostpreviousips |
multiSelect |
Vectra AI
|
No |
0 |
|
Vectra Host Targets Key Asset
|
vectrahosttargetskeyasset |
boolean |
Vectra AI
|
No |
0 |
|
Vectra Last Detection Timestamp
|
vectralastdetectiontimestamp |
date |
Vectra AI
|
No |
0 |
|
Vectra Privilege Category
|
vectraprivilegecategory |
shortText |
Vectra AI
|
No |
0 |
|
Vectra Privilege Level
|
vectraprivilegelevel |
shortText |
Vectra AI
|
No |
0 |
|
Vectra RUX AWS Region
|
vectraruxawsregion |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Access Key ID
|
vectraruxaccesskeyid |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Account ID
|
vectraruxaccountid |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Assumed Role
|
vectraruxassumedrole |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Certainty Score
|
vectraruxcertaintyscore |
number |
Vectra RUX
|
No |
0 |
|
Vectra RUX Data Source Sensor ID
|
vectraruxdatasourcesensorid |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Data Source Sensor Name
|
vectraruxdatasourcesensorname |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Data Source Type
|
vectraruxdatasourcetype |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Destination Account Information
|
vectraruxdestinationaccountinformation |
grid |
Vectra RUX
|
No |
0 |
|
Vectra RUX Destination Domain Information
|
vectraruxdestinationdomaininformation |
grid |
Vectra RUX
|
No |
0 |
|
Vectra RUX Destination Host Information
|
vectraruxdestinationhostinformation |
grid |
Vectra RUX
|
No |
0 |
|
Vectra RUX Detection Category
|
vectraruxdetectioncategory |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Detection ID
|
vectraruxdetectionid |
number |
Vectra RUX
|
No |
0 |
|
Vectra RUX Detection Notes
|
vectraruxdetectionnotes |
longText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Detection Reason
|
vectraruxdetectionreason |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Detection Type
|
vectraruxdetectiontype |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Assignment Assigned By
|
vectraruxentityassignmentassignedby |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Assignment Assigned Date
|
vectraruxentityassignmentassigneddate |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Assignment Assigned to
|
vectraruxentityassignmentassignedto |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Assignment Details
|
vectraruxentityassignmentdetails |
longText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Assignment ID
|
vectraruxentityassignmentid |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Assignment Outcome
|
vectraruxentityassignmentoutcome |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Assignment Resolved By
|
vectraruxentityassignmentresolvedby |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Assignment Resolved Date
|
vectraruxentityassignmentresolveddate |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity External Reference ID
|
vectraruxentityexternalreferenceid |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity ID
|
vectraruxentityid |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity IP
|
vectraruxentityip |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Importance
|
vectraruxentityimportance |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Name
|
vectraruxentityname |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Priority Status
|
vectraruxentityprioritystatus |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Privilege Category
|
vectraruxentityprivilegecategory |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Type
|
vectraruxentitytype |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity UID
|
vectraruxentityuid |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity URL
|
vectraruxentityurl |
url |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Unresolved Priority Status
|
vectraruxentityunresolvedprioritystatus |
boolean |
Vectra RUX
|
No |
0 |
|
Vectra RUX Entity Urgency Score
|
vectraruxentityurgencyscore |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event Accounts
|
vectraruxeventaccounts |
longText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event Change Type
|
vectraruxeventchangetype |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event DNS
|
vectraruxeventdns |
longText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event Domains
|
vectraruxeventdomains |
longText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event External Targets
|
vectraruxeventexternaltargets |
longText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event Hosts
|
vectraruxeventhosts |
longText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event IPs
|
vectraruxeventips |
longText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event Name
|
vectraruxeventname |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event Ports
|
vectraruxeventports |
longText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event Protocols
|
vectraruxeventprotocols |
longText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event Severity
|
vectraruxeventseverity |
number |
Vectra RUX
|
No |
0 |
|
Vectra RUX Event Timestamp
|
vectraruxeventtimestamp |
date |
Vectra RUX
|
No |
0 |
|
Vectra RUX External Reference ID
|
vectraruxexternalreferenceid |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Identity Type
|
vectraruxidentitytype |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Investigation Status
|
vectraruxinvestigationstatus |
singleSelect |
Vectra RUX
|
No |
0 |
|
Vectra RUX Is Event Triaged
|
vectraruxiseventtriaged |
boolean |
Vectra RUX
|
No |
0 |
|
Vectra RUX Last Timestamp
|
vectraruxlasttimestamp |
date |
Vectra RUX
|
No |
0 |
|
Vectra RUX Mitre IDs
|
vectraruxmitreids |
longText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Process Context Date Created
|
vectraruxprocesscontextdatecreated |
date |
Vectra RUX
|
No |
0 |
|
Vectra RUX Process Context Error Message
|
vectraruxprocesscontexterrormessage |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Process Context Investigate Entity Link
|
vectraruxprocesscontextinvestigateentitylink |
url |
Vectra RUX
|
No |
0 |
|
Vectra RUX Process Context Processes
|
vectraruxprocesscontextprocesses |
grid |
Vectra RUX
|
No |
0 |
|
Vectra RUX Process Context Query Link
|
vectraruxprocesscontextquerylink |
url |
Vectra RUX
|
No |
0 |
|
Vectra RUX Process Context Query Status
|
vectraruxprocesscontextquerystatus |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Role Sequence
|
vectraruxrolesequence |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Source External Host IP
|
vectraruxsourceexternalhostip |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Source External Host Name
|
vectraruxsourceexternalhostname |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra RUX Threat Score
|
vectraruxthreatscore |
number |
Vectra RUX
|
No |
0 |
|
Vectra RUX User Agent
|
vectraruxuseragent |
shortText |
Vectra RUX
|
No |
0 |
|
Vectra Sensors
|
vectrasensors |
multiSelect |
Vectra AI
|
No |
0 |
|
Vectra Service Access History
|
vectraserviceaccesshistory |
grid |
Vectra AI
|
No |
0 |
|
Vectra Threat Score
|
vectrathreatscore |
number |
Vectra AI
|
No |
0 |
|
Vectra XDR Entity Account Type
|
vectraxdrentityaccounttype |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Assignment Assigned By
|
vectraxdrentityassignmentassignedby |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Assignment Assigned Date
|
vectraxdrentityassignmentassigneddate |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Assignment Assigned to
|
vectraxdrentityassignmentassignedto |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Assignment Details
|
vectraxdrentityassignmentdetails |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Assignment ID
|
vectraxdrentityassignmentid |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Assignment Outcome
|
vectraxdrentityassignmentoutcome |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Assignment Resolved By
|
vectraxdrentityassignmentresolvedby |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Assignment Resolved Date
|
vectraxdrentityassignmentresolveddate |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Attack Profile
|
vectraxdrentityattackprofile |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Attack Rating
|
vectraxdrentityattackrating |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Detection Details
|
vectraxdrentitydetectiondetails |
multiSelect |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Filter Tags
|
vectraxdrentityfiltertags |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Host Type
|
vectraxdrentityhosttype |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity ID
|
vectraxdrentityid |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity IP
|
vectraxdrentityip |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Importance
|
vectraxdrentityimportance |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Last Detection Timestamp
|
vectraxdrentitylastdetectiontimestamp |
date |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Last Modification Timestamp
|
vectraxdrentitylastmodificationtimestamp |
date |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Name
|
vectraxdrentityname |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Notes
|
vectraxdrentitynotes |
multiSelect |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Priority Status
|
vectraxdrentityprioritystatus |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity State
|
vectraxdrentitystate |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Type
|
vectraxdrentitytype |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Urgency Score
|
vectraxdrentityurgencyscore |
shortText |
Vectra XDR
|
No |
0 |
|
Vectra XDR Entity Velocity
|
vectraxdrentityvelocity |
shortText |
Vectra XDR
|
No |
0 |
|
Veeam Affected Machine
|
veeamaffectedmachine |
markdown |
Veeam App
|
No |
0 |
|
Veeam Alarm Status
|
veeamalarmstatus |
shortText |
Veeam App
|
No |
0 |
|
Veeam Alarm Template ID
|
veeamalarmtemplateid |
shortText |
Veeam App
|
No |
0 |
|
Veeam Alarm Template Name
|
veeamalarmtemplatename |
shortText |
Veeam App
|
No |
0 |
|
Veeam Assigned Object
|
veeamassignedobject |
markdown |
Veeam App
|
No |
0 |
|
Veeam Backup Object ID
|
veeambackupobjectid |
shortText |
Veeam App
|
No |
0 |
|
Veeam Backup Repository Capacity (GB)
|
veeambackuprepositorycapacitygb |
shortText |
Veeam App
|
No |
0 |
|
Veeam Backup Repository Free Space (GB)
|
veeambackuprepositoryfreespacegb |
shortText |
Veeam App
|
No |
0 |
|
Veeam Backup Repository ID
|
veeambackuprepositoryid |
shortText |
Veeam App
|
No |
0 |
|
Veeam Backup Repository Name
|
veeambackuprepositoryname |
shortText |
Veeam App
|
No |
0 |
|
Veeam Backup Repository Used Space (GB)
|
veeambackuprepositoryusedspacegb |
shortText |
Veeam App
|
No |
0 |
|
Veeam Backup Scheduling
|
veeambackupscheduling |
markdown |
Veeam App
|
No |
0 |
|
Veeam Encryption
|
veeamencryption |
markdown |
Veeam App
|
No |
0 |
|
Veeam Event Source Description
|
veeameventsourcedescription |
shortText |
Veeam App
|
No |
0 |
|
Veeam Event Type Description
|
veeameventtypedescription |
shortText |
Veeam App
|
No |
0 |
|
Veeam Is Enabled
|
veeamisenabled |
boolean |
Veeam App
|
No |
0 |
|
Veeam Last Successful Backup
|
veeamlastsuccessfulbackup |
markdown |
Veeam App
|
No |
0 |
|
Veeam Malware Detection Method
|
veeammalwaredetectionmethod |
shortText |
Veeam App
|
No |
0 |
|
Veeam Malware Detection Time
|
veeammalwaredetectiontime |
shortText |
Veeam App
|
No |
0 |
|
Veeam Malware Status
|
veeammalwarestatus |
shortText |
Veeam App
|
No |
0 |
|
Veeam Notifications
|
veeamnotifications |
markdown |
Veeam App
|
No |
0 |
|
Veeam Number of Stored Restore Points
|
veeamnumberofstoredrestorepoints |
number |
Veeam App
|
No |
0 |
|
Veeam Number of Triggered Alarms
|
veeamnumberoftriggeredalarms |
shortText |
Veeam App
|
No |
0 |
|
Veeam Remediation
|
veeamremediation |
markdown |
Veeam App
|
No |
0 |
|
Veeam Triggered Time
|
veeamtriggeredtime |
shortText |
Veeam App
|
No |
0 |
|
Vendor ID
|
vendorid |
shortText |
Common Types
|
No |
0 |
|
Vendor Product
|
vendorproduct |
shortText |
Common Types
|
No |
0 |
|
Verdict
|
verdict |
shortText |
Common Types
|
No |
0 |
|
Verification Method
|
verificationmethod |
shortText |
Common Types
|
No |
0 |
|
Verification Status
|
verificationstatus |
shortText |
Common Types
|
No |
0 |
|
Vulnerability Category
|
vulnerabilitycategory |
shortText |
Common Types
|
No |
0 |
|
Vulnerability Protection Profile Name
|
vulnerabilityprotectionprofilename |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Vulnerability Protection Profile Status
|
vulnerabilityprotectionprofilestatus |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Vulnerability Protection Rules
|
vulnerabilityprotectionrules |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Vulnerable Product
|
vulnerableproduct |
shortText |
Common Types
|
No |
0 |
|
Watcher
|
watcher |
shortText |
Intel471 Feed
|
No |
0 |
|
Watcher Group
|
watchergroup |
shortText |
Intel471 Feed
|
No |
0 |
|
Were any steps or actions taken that might have inhibited the recovery?
|
wereanystepsoractionstakenthatmighthaveinhibitedtherecovery |
shortText |
NIST
|
No |
0 |
|
What additional tools or resources are needed to detect, analyze, and mitigate future incidents?
|
whatadditionaltoolsorresourcesareneededtodetectanalyzeandmitigatefutureincidents |
shortText |
NIST
|
No |
0 |
|
What are the areas that need improvement?
|
whataretheareasthatneedimprovement |
shortText |
SANS
|
No |
0 |
|
What corrective actions can prevent similar incidents in the future?
|
whatcorrectiveactionscanpreventsimilarincidentsinthefuture |
shortText |
NIST
|
No |
0 |
|
What information was needed sooner?
|
whatinformationwasneededsooner |
shortText |
NIST
|
No |
0 |
|
What precursors or indicators should be watched for in the future to detect similar incidents?
|
whatprecursorsorindicatorsshouldbewatchedforinthefuturetodetectsimilarincidents |
shortText |
NIST
|
No |
0 |
|
What was the scope of the incident?
|
whatwasthescopeoftheincident |
shortText |
SANS
|
No |
0 |
|
What was the work performed during recovery?
|
whatwastheworkperformedduringrecovery |
shortText |
SANS
|
No |
0 |
|
What were the areas where the CIRT teams were effective?
|
whatweretheareaswherethecirtteamswereeffective |
shortText |
SANS
|
No |
0 |
|
What would the staff and management do differently the next time a similar incident occurs?
|
whatwouldthestaffandmanagementdodifferentlythenexttimeasimilarincidentoccurs |
shortText |
NIST
|
No |
0 |
|
When was the problem first detected and by whom?
|
whenwastheproblemfirstdetectedandbywhom |
shortText |
SANS
|
No |
0 |
|
Where is data hosted
|
whereisdatahosted |
multiSelect |
Common Scripts
|
No |
0 |
|
WildFire Profile Name
|
wildfireprofilename |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
WildFire Profile Status
|
wildfireprofilestatus |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
WildFire Rules
|
wildfirerules |
shortText |
MITRE ATT&CK - Courses of Action
|
No |
0 |
|
Wiz Cloud Account
|
wizcloudaccount |
shortText |
Wiz
|
No |
0 |
|
Wiz Cloud Account Name
|
wizcloudaccountname |
shortText |
Wiz
|
No |
0 |
|
Wiz Cloud Platform
|
wizcloudplatform |
shortText |
Wiz
|
No |
0 |
|
Wiz Details
|
wizdetails |
shortText |
Wiz
|
No |
0 |
|
Wiz Detection ID
|
wizdetectionid |
shortText |
Wiz
|
No |
0 |
|
Wiz Detection URL
|
wizdetectionurl |
url |
Wiz
|
No |
0 |
|
Wiz Issue Due Date
|
wizissueduedate |
shortText |
Wiz
|
No |
0 |
|
Wiz Issue ID
|
wizissueid |
shortText |
Wiz
|
No |
0 |
|
Wiz Issue Note
|
wizissuenote |
shortText |
Wiz
|
No |
0 |
|
Wiz Issue Projects
|
wizissueprojects |
shortText |
Wiz
|
No |
0 |
|
Wiz Issue Resolution Recommendation
|
wizissueresolutionrecommendation |
markdown |
Wiz
|
No |
0 |
|
Wiz Issue URL
|
wizissueurl |
shortText |
Wiz
|
No |
0 |
|
Wiz Project Owners
|
wizprojectowners |
shortText |
Wiz
|
No |
0 |
|
Wiz Project Security Champions
|
wizprojectsecuritychampions |
shortText |
Wiz
|
No |
0 |
|
Wiz Resource Cloud ID
|
wizresourcecloudid |
shortText |
Wiz
|
No |
0 |
|
Wiz Resource ID
|
wizresourceid |
shortText |
Wiz
|
No |
0 |
|
Wiz Resource Native Type
|
wizresourcenativetype |
shortText |
Wiz
|
No |
0 |
|
Wiz Resource Region
|
wizresourceregion |
shortText |
Wiz
|
No |
0 |
|
Wiz Resource Type
|
wizresourcetype |
shortText |
Wiz
|
No |
0 |
|
Work Phone
|
workphone |
shortText |
Common Types
|
No |
0 |
|
Workflow Name
|
workflowname |
shortText |
FireMon Security Manager
|
No |
0 |
|
XDR Alert Category
|
xdralertcategory |
multiSelect |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Alert Count
|
xdralertcount |
number |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Alert Name
|
xdralertname |
multiSelect |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Alert Search Results
|
xdralertsearchresults |
grid |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Alerts
|
xdralerts |
grid |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Assigned User Email
|
xdrassigneduseremail |
shortText |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Assigned User Pretty Name
|
xdrassigneduserprettyname |
shortText |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR BPA Access Management
|
xdrbpaaccessmanagement |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Access Management Recommendation
|
xdrbpaaccessmanagementrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Agent Groups
|
xdrbpaagentgroups |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Agent Groups Recommendation
|
xdrbpaagentgroupsrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Agent Install Packages
|
xdrbpaagentinstallpackages |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Agent Install Recommendation
|
xdrbpaagentinstallrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Agent Profile
|
xdrbpaagentprofile |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Agent Profile Recommendation
|
xdrbpaagentprofilerecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Agent VDI Flag
|
xdrbpaagentvdiflag |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Agent VDI Flag Recommendation
|
xdrbpaagentvdiflagrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Agent Versions
|
xdrbpaagentversions |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Agent Versions Recommendation
|
xdrbpaagentversionsrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Alert Exclusions
|
xdrbpaalertexclusions |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Alert Exclusions Recommendation
|
xdrbpaalertexclusionsrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Alerting
|
xdrbpaalerting |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Alerting Recommendation
|
xdrbpaalertingrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Broker VM
|
xdrbpabrokervm |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Broker VM Recommendation
|
xdrbpabrokervmrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Content Versions
|
xdrbpacontentversions |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Content Versions Recommendation
|
xdrbpacontentversionsrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Dashboards
|
xdrbpadashboards |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Dashboards Recommendations
|
xdrbpadashboardsrecommendations |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Deployment Strategy
|
xdrbpadeploymentstrategy |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Deployment Strategy Recommendation
|
xdrbpadeploymentstrategyrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Device Control Profile
|
xdrbpadevicecontrolprofile |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Device Control Recommendation
|
xdrbpadevicecontrolrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Device Exceptions
|
xdrbpadeviceexceptions |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Device Exceptions Recommendation
|
xdrbpadeviceexceptionsrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Disk Encryption
|
xdrbpadiskencryption |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Disk Encryption Recommendation
|
xdrbpadiskencryptionrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Exception Profile
|
xdrbpaexceptionprofile |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Exception Profile Recommendation
|
xdrbpaexceptionprofilerecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Exploit Profile
|
xdrbpaexploitprofile |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Exploit Profile Recommendation
|
xdrbpaexploitprofilerecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA General Settings
|
xdrbpageneralsettings |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA General Settings Recommendation
|
xdrbpageneralsettingsrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Host Firewall
|
xdrbpahostfirewall |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Host Firewall Recommendation
|
xdrbpahostfirewallrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Host Isolation
|
xdrbpahostisolation |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Host Isolation Recommendation
|
xdrbpahostisolationrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Integrations
|
xdrbpaintegrations |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Integrations Recommendation
|
xdrbpaintegrationsrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Live Terminal
|
xdrbpaliveterminal |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Live Terminal Recommendation
|
xdrbpaliveterminalrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Malware Profile
|
xdrbpamalwareprofile |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Malware Profile Recommendation
|
xdrbpamalwareprofilerecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Management Overview
|
xdrbpamanagementoverview |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Management Overview Recommendation
|
xdrbpamanagementoverviewrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Other Actions
|
xdrbpaotheractions |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Other Actions Recommendation
|
xdrbpaotheractionsrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Policy Strategy
|
xdrbpapolicystrategy |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Policy Strategy Recommendation
|
xdrbpapolicystrategyrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Process Exceptions
|
xdrbpaprocessexceptions |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Process Exceptions Recommendation
|
xdrbpaprocessexceptionsrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Reports
|
xdrbpareports |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Reports Recommendation
|
xdrbpareportsrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Response Overview
|
xdrbparesponseoverview |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Response Overview Recommendation
|
xdrbparesponseoverviewrecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Restriction Profile
|
xdrbparestrictionprofile |
longText |
XDR Best Practice Assessment
|
No |
0 |
|
XDR BPA Restriction Profile Recommendation
|
xdrbparestrictionprofilerecommendation |
markdown |
XDR Best Practice Assessment
|
No |
0 |
|
XDR Description
|
xdrdescription |
shortText |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Detection Time
|
xdrdetectiontime |
date |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Disconnected endpoints
|
xdrdisconnectedendpoints |
grid |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR File Artifacts
|
xdrfileartifacts |
grid |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR File Name
|
xdrfilename |
multiSelect |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR File SHA256
|
xdrfilesha256 |
multiSelect |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR High Severity Alert Count
|
xdrhighseverityalertcount |
number |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Host Count
|
xdrhostcount |
number |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Incident ID
|
xdrincidentid |
shortText |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Investigation results
|
xdrinvestigationresults |
grid |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Low Severity Alert Count
|
xdrlowseverityalertcount |
number |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR MITRE Tactics
|
xdrmitretactics |
multiSelect |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR MITRE Techniques
|
xdrmitretechniques |
multiSelect |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Medium Severity Alert Count
|
xdrmediumseverityalertcount |
number |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Modification Time
|
xdrmodificationtime |
date |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Network Artifacts
|
xdrnetworkartifacts |
grid |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Notes
|
xdrnotes |
shortText |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Resolve Comment
|
xdrresolvecomment |
shortText |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Risky Host Count
|
xdrriskyhostcount |
number |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Risky Hosts
|
xdrriskyhosts |
grid |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Risky User Count
|
xdrriskyusercount |
number |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Risky Users
|
xdrriskyusers |
grid |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Similar Incidents
|
xdrsimilarincidents |
grid |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Starred
|
xdrstarred |
boolean |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Status
|
xdrstatus |
shortText |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Status v2
|
xdrstatusv2 |
singleSelect |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR URL
|
xdrurl |
url |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR User Count
|
xdrusercount |
number |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR Users
|
xdrusers |
multiSelect |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR device control violations
|
xdrdevicecontrolviolations |
grid |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XDR manual severity
|
xdrmanualseverity |
shortText |
Cortex XDR by Palo Alto Networks
|
No |
0 |
|
XFF
|
xff |
multiSelect |
Core Alert Fields
|
No |
0 |
|
XM Cyber MITRE
|
xmcybermitre |
grid |
XM Cyber
|
No |
0 |
|
XM Cyber advices
|
xmcyberadvices |
grid |
XM Cyber
|
No |
0 |
|
XM Cyber avg. complexity level
|
xmcyberavgcomplexitylevel |
shortText |
XM Cyber
|
No |
0 |
|
XM Cyber avg. complexity score
|
xmcyberavgcomplexityscore |
number |
XM Cyber
|
No |
0 |
|
XM Cyber critical assets trend
|
xmcybercriticalassetstrend |
number |
XM Cyber
|
No |
0 |
|
XM Cyber current security score
|
xmcybercurrentsecurityscore |
number |
XM Cyber
|
No |
0 |
|
XM Cyber dashboard
|
xmcyberdashboard |
url |
XM Cyber
|
No |
0 |
|
XM Cyber description
|
xmcyberdescription |
longText |
XM Cyber
|
No |
0 |
|
XM Cyber report
|
xmcyberreport |
url |
XM Cyber
|
No |
0 |
|
XM Cyber security score grade
|
xmcybersecurityscoregrade |
shortText |
XM Cyber
|
No |
0 |
|
XM Cyber security score trend
|
xmcybersecurityscoretrend |
number |
XM Cyber
|
No |
0 |
|
XMCO Serenety identification
|
xmcoserenetyidentification |
shortText |
XMCO
|
No |
0 |
|
XMCO Serenety monitoring
|
xmcoserenetymonitoring |
shortText |
XMCO
|
No |
0 |
|
XSOAR Architecture
|
xsoararchitecture |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Build
|
xsoarbuild |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR CPU
|
xsoarcpu |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Content Version
|
xsoarcontentversion |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Customer Name
|
xsoarcustomername |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR DR
|
xsoardr |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Dev Instance Name
|
xsoardevinstancename |
shortText |
XSOAR - Simple Dev to Prod
|
No |
0 |
|
XSOAR Dev to Prod Method
|
xsoardevtoprodmethod |
shortText |
XSOAR - Simple Dev to Prod
|
No |
0 |
|
XSOAR Dev-Prod
|
xsoardevprod |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Dev-Prod Mode
|
xsoardevprodmode |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Elastic Search
|
xsoarelasticsearch |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Incident Flow
|
xsoarincidentflow |
html |
Use Case Builder
|
No |
0 |
|
XSOAR License
|
xsoarlicense |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR License Valid Till
|
xsoarlicensevalidtill |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Memory
|
xsoarmemory |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Multi-Repo
|
xsoarmultirepo |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Multi-Tenant
|
xsoarmultitenant |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Number Of DB Partitions
|
xsoarnumberofdbpartitions |
number |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR OS
|
xsoaros |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Prod Instance Name
|
xsoarprodinstancename |
shortText |
XSOAR - Simple Dev to Prod
|
No |
0 |
|
XSOAR Server Configuration
|
xsoarserverconfiguration |
grid |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Telemetry Status
|
xsoartelemetrystatus |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
XSOAR Version
|
xsoarversion |
shortText |
System Diagnostics and Health Check
|
No |
0 |
|
Xpanse Alert ID
|
xpansealertid |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Asset IDs
|
xpanseassetids |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Attack Surface Rule Name
|
xpanseattacksurfacerulename |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Business Units
|
xpansebusinessunits |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Category
|
xpansecategory |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Certificate Asset
|
xpansecertificateasset |
grid |
Cortex Xpanse
|
No |
0 |
|
Xpanse Cloud Asset
|
xpansecloudasset |
grid |
Cortex Xpanse
|
No |
0 |
|
Xpanse Country Code
|
xpansecountrycode |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Description
|
xpansedescription |
markdown |
Cortex Xpanse
|
No |
0 |
|
Xpanse Domain Asset
|
xpansedomainasset |
grid |
Cortex Xpanse
|
No |
0 |
|
Xpanse External ID
|
xpanseexternalid |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Host Name
|
xpansehostname |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse IP
|
xpanseip |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Port
|
xpanseport |
number |
Cortex Xpanse
|
No |
0 |
|
Xpanse Progress Status
|
xpanseprogressstatus |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Protocol
|
xpanseprotocol |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Provider
|
xpanseprovider |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Remediation Guidance
|
xpanseremediationguidance |
markdown |
Cortex Xpanse
|
No |
0 |
|
Xpanse Responsive IP Asset
|
xpanseresponsiveipasset |
grid |
Cortex Xpanse
|
No |
0 |
|
Xpanse Service Classifications
|
xpanseserviceclassifications |
grid |
Cortex Xpanse
|
No |
0 |
|
Xpanse Service Details
|
xpanseservicedetails |
grid |
Cortex Xpanse
|
No |
0 |
|
Xpanse Service ID
|
xpanseserviceid |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xpanse Service Validation
|
xpanseservicevalidation |
grid |
Cortex Xpanse
|
No |
0 |
|
Xpanse Tags
|
xpansetags |
shortText |
Cortex Xpanse
|
No |
0 |
|
Xsoar-web-server Email Send Counter
|
xsoarwebserveremailsendcounter |
number |
Xsoar-web-server
|
No |
0 |
|
Xsoar-web-server Email User SLA
|
xsoarwebserveremailusersla |
timer |
Xsoar-web-server
|
No |
0 |
|
ZTAP Alert ID
|
ztapalertid |
shortText |
Zero Trust Analytics Platform
|
No |
0 |
|
ZTAP Alert Link
|
ztapalertlink |
url |
Zero Trust Analytics Platform
|
No |
0 |
|
ZTAP Assigned Organization
|
ztapassignedorganization |
shortText |
Zero Trust Analytics Platform
|
No |
0 |
|
ZTAP Input Tag
|
ztapinputtag |
shortText |
Zero Trust Analytics Platform
|
No |
0 |
|
ZTAP Priority
|
ztappriority |
shortText |
Zero Trust Analytics Platform
|
No |
0 |
|
ZTAP Product Status
|
ztapproductstatus |
shortText |
Zero Trust Analytics Platform
|
No |
0 |
|
ZTAP Source Organization
|
ztapsourceorganization |
shortText |
Zero Trust Analytics Platform
|
No |
0 |
|
ZTAP Status
|
ztapstatus |
shortText |
Zero Trust Analytics Platform
|
No |
0 |
|
ZTAP Trigger Count
|
ztaptriggercount |
number |
Zero Trust Analytics Platform
|
No |
0 |
|
ZTAP Triggers
|
ztaptriggers |
grid |
Zero Trust Analytics Platform
|
No |
0 |
|
Zendesk CC'd
|
zendeskccd |
shortText |
Zendesk
|
No |
0 |
|
Zendesk Collaborators
|
zendeskcollaborators |
shortText |
Zendesk
|
No |
0 |
|
Zendesk Custom Fields
|
zendeskcustomfields |
shortText |
Zendesk
|
No |
0 |
|
Zendesk Followers
|
zendeskfollowers |
shortText |
Zendesk
|
No |
0 |
|
Zendesk Forum Id
|
zendeskforumid |
number |
Zendesk
|
No |
0 |
|
Zendesk Organization
|
zendeskorganization |
shortText |
Zendesk
|
No |
0 |
|
Zendesk Problem Id
|
zendeskproblemid |
number |
Zendesk
|
No |
0 |
|
Zendesk Recipient
|
zendeskrecipient |
shortText |
Zendesk
|
No |
0 |
|
Zendesk Requester
|
zendeskrequester |
shortText |
Zendesk
|
No |
0 |
|
Zendesk Ticket Type
|
zendesktickettype |
singleSelect |
Zendesk
|
No |
0 |
|
ZeroFox Key Incident Analysis
|
zerofoxkeyincidentanalysis |
longText |
ZeroFox
|
No |
0 |
|
ZeroFox Key Incident Headline
|
zerofoxkeyincidentheadline |
shortText |
ZeroFox
|
No |
0 |
|
Zimperium Bundle ID
|
zimperiumbundleid |
shortText |
Zimperium
|
No |
0 |
|
Zip Code
|
zipcode |
shortText |
Common Types
|
No |
0 |
|
adversaries
|
adversaries |
multiSelect |
Lumu
|
No |
0 |
|
adversaryId
|
adversaryid |
shortText |
Lumu
|
No |
0 |
|
adversaryTypes
|
adversarytypes |
multiSelect |
Lumu
|
No |
0 |
|
app channel name
|
appchannelname |
shortText |
Common Types
|
No |
0 |
|
appsubcategory
|
appsubcategory |
multiSelect |
Core Alert Fields
|
No |
0 |
|
companyId
|
companyid |
shortText |
Lumu
|
No |
0 |
|
contactSummary
|
contactsummary |
shortText |
Lumu
|
No |
0 |
|
failed incidents created date
|
failedincidentscreateddate |
shortText |
Integrations & Incidents Health Check
|
No |
0 |
|
firstContact
|
firstcontact |
shortText |
Lumu
|
No |
0 |
|
fwserials
|
fwserials |
shortText |
PAN-OS to Strata Logging Service Monitoring
|
No |
0 |
|
impacted devices
|
impacteddevices |
shortText |
Microsoft 365 Defender
|
No |
0 |
|
impacted entities
|
impactedentities |
shortText |
Microsoft 365 Defender
|
No |
0 |
|
labelDistribution
|
labeldistribution |
shortText |
Lumu
|
No |
0 |
|
lastContact
|
lastcontact |
shortText |
Lumu
|
No |
0 |
|
lumu_actions
|
lumuactions |
grid |
Lumu
|
No |
0 |
|
lumu_contacts
|
lumucontacts |
number |
Lumu
|
No |
0 |
|
lumu_description
|
lumudescription |
shortText |
Lumu
|
No |
0 |
|
lumu_event_type
|
lumueventtype |
shortText |
Lumu
|
No |
0 |
|
lumu_incidentId
|
lumuincidentid |
shortText |
Lumu
|
No |
0 |
|
lumu_source_name
|
lumusourcename |
shortText |
Lumu
|
No |
0 |
|
lumu_status
|
lumustatus |
singleSelect |
Lumu
|
No |
0 |
|
lumu_totalEndpoints
|
lumutotalendpoints |
number |
Lumu
|
No |
0 |
|
panosintegrationinstancename
|
panosintegrationinstancename |
shortText |
PAN-OS to Strata Logging Service Monitoring
|
No |
0 |
|
sAMAccountName
|
samaccountname |
shortText |
Common Types
|
No |
0 |
|
similarIncident
|
similarincident |
multiSelect |
Integrations & Incidents Health Check
|
No |
0 |
|
similarIncidents
|
similarincidents |
multiSelect |
Common Types
|
No |
0 |
|
statusTimestamp
|
statustimestamp |
shortText |
Lumu
|
No |
0 |
|
subclassification
|
subclassification |
multiSelect |
Use Case Builder
|
No |
0 |
|
userAccountControl
|
useraccountcontrol |
shortText |
Common Types
|
No |
0 |